Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29699 produits trouvés pour "Peptides"
beta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Adrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molCJC-1295
CAS :CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.
Degré de pureté :Min. 95%Alpha-Dendrotoxin
CAS :Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formule :C305H472N98O84S6Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :7,048.02 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molMastoparan 7
Catalogue peptide; min. 95% purity
Formule :C67H124N18O15Masse moléculaire :1,421.85 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/molHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C56H85N17O13Masse moléculaire :1,204.41 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/mol
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
