Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29707 produits trouvés pour "Peptides"
Z-Asp-Gln-Met-Asp-AFC
CAS :Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C36H39F3N6O13SDegré de pureté :Min. 95%Masse moléculaire :852.79 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dok-5 (263-275)
Catalogue peptide; min. 95% purity
Formule :C75H114N24O19Masse moléculaire :1,655.89 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Adrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molMastoparan 7
Catalogue peptide; min. 95% purity
Formule :C67H124N18O15Masse moléculaire :1,421.85 g/molSaposin C18
Catalogue peptide; min. 95% purity
Formule :C93H164N24O31Masse moléculaire :2,114.49 g/molgp100 (570-579)
Catalogue peptide; min. 95% purity
Formule :C41H71N11O17Masse moléculaire :990.09 g/molH-Asp-beta-Ala-OH
CAS :Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H12N2O5Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formule :C42H66N10O15Masse moléculaire :951.05 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Formule :C171H254N4O16Masse moléculaire :3,870.52 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/molMBP (90-106)
Catalogue peptide; min. 95% purity
Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molH-D-Phe-pip-Arg-pna acetate
CAS :H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molRef: 3D-QEA38896
Produit arrêtéHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/mol
