Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29795 produits trouvés pour "Peptides"
Biotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS :Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C53H80N20O18Degré de pureté :Min. 95%Masse moléculaire :1,285.3 g/molH-His-Arg-OH
CAS :H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formule :C176H251N43O53SMasse moléculaire :3,849.30 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molNps-Val-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C11H14N2O4S·C12H23NDegré de pureté :Min. 95%Masse moléculaire :451.62 g/molH-Asp-beta-Ala-OH
CAS :Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H12N2O5Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/mol
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
