Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30471 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TAPI-O
<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HiGom
<p>HiGom is a venom that belongs to the group of proteins that can produce reactive oxygen species. It has been shown to inhibit mitochondrial membrane potential, cellular viability, and the production of reactive oxygen species. HiGom has also been shown to inhibit the production of inflammatory cytokines and chemokines in response to chronic pain. This protein may be useful for cancer treatment as it has been shown to inhibit tumor growth by inducing apoptosis and inhibiting angiogenesis.</p>Formule :C92H150N38O23S4Degré de pureté :Min. 95%Masse moléculaire :2,284.72 g/molH-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-SAYVSYDVQK^R^-OH
<p>Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thymosin β 4
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C212H350N56O78SMasse moléculaire :4,963.5 g/molAngiotensin II (3-8), human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C40H54N8O8Masse moléculaire :774.9 g/molH-KLVVVGAVGV^-OH
<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Glucagon-Like Peptide I (7-36), amide, human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C149H226N40O45Masse moléculaire :3,297.7 g/molMelanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C44H67N9O14Masse moléculaire :946.05 g/molCMVpp65 - 107 (AMAGASTSAGRKRKS)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,478.7 g/molH-ILGQQVPYATK^-OH
<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Leu
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C17H33N3O4Masse moléculaire :343.46 g/molAngiotensin I, human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C62H89N17O14Masse moléculaire :1,296.5 g/molCyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS :<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>Formule :C27H41N9O7Degré de pureté :Min. 95%Masse moléculaire :603.68 g/molH-GISYGRQ^LG^KK^KHRR^RAHQ-OH
<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-2
<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVYHLGLPFSFLTFPYVEEAIK^-OH
<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EBV BRLF-1 148-156 (HLA-A*03:01)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :TKSVY2Masse moléculaire :1,143.3 g/mol
