CAS 197922-42-2

Teduglutide

Descrizione:

Teduglutide è un analogo sintetico del peptide simile al glucagone umano-2 (GLP-2), un ormone coinvolto nella regolazione della crescita e della funzione intestinale. È utilizzato principalmente nel trattamento della sindrome dell'intestino corto, una condizione che può insorgere dopo la rimozione chirurgica di una parte significativa dell'intestino. Teduglutide promuove l'assorbimento intestinale di nutrienti e fluidi, migliorando così la qualità della vita dei pazienti con questa condizione. La sostanza viene somministrata tramite iniezione sottocutanea e ha una emivita relativamente lunga grazie alla sua resistenza alla degradazione enzimatica. Il suo meccanismo d'azione implica il legame al recettore del GLP-2, portando a una crescita migliorata della mucosa intestinale, un aumento dell'altezza dei villi e un miglior assorbimento dei nutrienti. Gli effetti collaterali comuni possono includere sintomi gastrointestinali, come nausea e dolore addominale, così come potenziali rischi di neoplasia a causa dei suoi effetti promotori della crescita. In generale, Teduglutide rappresenta un avanzamento significativo nella gestione della sindrome dell'intestino corto, offrendo ai pazienti un miglior stato nutrizionale e una ridotta dipendenza dal supporto parenterale.

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Sinonimi:

• Alx 0600

ALX 0600

CAS: 197922-42-2

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purezza: 98%

Colore e forma: Solid

Peso molecolare: 3752.0825

Ref: IN-DA00ACKN

Teduglutide

CAS: 197922-42-2

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Peso molecolare: 3752.13

Ref: 4Z-PT-312001

Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)

Prodotto controllato

CAS: 197922-42-2

Applications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)

Formula: C₁₆₄H₂₄₄D₈N₄₄O₅₅S•C₂HF₃O₂•x(H₂O)

Colore e forma: Neat

Peso molecolare: 3760.081140218

Ref: TR-T013798

Teduglutide

CAS: 197922-42-2

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purezza: 98.08%

Colore e forma: Solid

Peso molecolare: 3752.08

Ref: TM-T35337

Teduglutide

CAS: 197922-42-2

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purezza: Min. 95%

Peso molecolare: 3,752.16 g/mol

Ref: 3D-TED-3880-PI

Teduglutide (GLP2 2G)

CAS: 197922-42-2

Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Colore e forma: Powder

Peso molecolare: 3,749.8 g/mol

Ref: 3D-CRB1000390

Teduglutide trifluoroacetate

CAS: 197922-42-2

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Peso molecolare: 3,752.08 g/mol

Ref: 3D-PP50564