CAS 90880-35-6

neuropeptide Y umano

Descrizione:

Il neuropeptide Y (NPY) è un peptide di 36 aminoacidi che svolge un ruolo cruciale in vari processi fisiologici, inclusa la regolazione dell'appetito, i ritmi circadiani e la risposta allo stress. È prodotto principalmente nel sistema nervoso centrale ed è coinvolto nella neurotrasmissione. La forma umana del neuropeptide Y, identificata dal numero CAS 90880-35-6, mostra un alto grado di conservazione tra le specie, indicando la sua fondamentale importanza biologica. L'NPY funziona legandosi a recettori specifici, principalmente ai recettori Y1 e Y2, che sono recettori accoppiati a proteine G. Questo legame può influenzare una serie di risposte cellulari, inclusa la modulazione del rilascio di neurotrasmettitori e la regolazione dell'equilibrio energetico. Inoltre, l'NPY è implicato in varie condizioni patologiche, come obesità, ansia e depressione, rendendolo un obiettivo per la ricerca terapeutica. La sua stabilità e bioattività sono influenzate da fattori come le modifiche post-traduzionali e la presenza di sottotipi specifici di recettori, evidenziando la sua complessità come molecola di segnalazione nel sistema nervoso.

Formula: C₁₈₉H₂₈₄N₅₅O₅₇RS

Sinonimi:

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
• hnpy
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• Neuropeptide Y (29-64), amide, human
• Neuropeptide Y (huMan, rat)
• hNPY, NPY
• Neuropeptide Y (Alligator mississippiensis)
• Neuropeptide Y (human, rat) Acetate
• NEUROPEPTIDE Y (HUMAN, RAT)
• Human neuropeptide Y (29-64)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• M.W. 4271.68 C189H285N55O57S
• Neuropeptide Y (rat)
• NPY (HUMAN, RAT)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• Neuropeptide Y (Gopherus agassizii)
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• Neuropeptide Y (human pheochromocytoma)
• NPY (huMan, rat)
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
• Neuropeptide Y(1-36)

Neuropeptide Y, Human

CAS: 90880-35-6

For cellular and molecular biology applications

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Peso molecolare: 4271.74

Ref: 02-J66797

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Bachem ID: 4012616.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: 95.2%

Colore e forma: White

Peso molecolare: 4271.74

Ref: 01-4012616

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Formula: C₆₅H₁₄₂N₂₆O₃

Purezza: 98%

Peso molecolare: 1335.9954

Ref: IN-DA00GRZM

Neuropeptide Y (human)

CAS: 90880-35-6

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: 98%

Colore e forma: Solid

Peso molecolare: 4271.68

Ref: TM-TP1140

Neuropeptide Y

CAS: 90880-35-6

Neuropeptide Y

Ref: 54-BIBA1035

NPY (Human, Rat)

CAS: 90880-35-6

NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: Min. 95%

Peso molecolare: 4,271.7 g/mol

Ref: 3D-PNP-4158-S

Neuropeptide Y, human

CAS: 90880-35-6

Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: Min. 95%

Peso molecolare: 4,271.69 g/mol

Ref: 3D-FN73521

NPY (Human, Rat)

CAS: 90880-35-6

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: Min. 95%

Peso molecolare: 4,271.7 g/mol

Ref: 3D-PNP-4158-V

Neuropeptide Y (human, rat) trifluoroacetate salt

CAS: 90880-35-6

Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purezza: Min. 95%

Peso molecolare: 4,271.69 g/mol

Ref: 3D-FN109816