CAS 90880-35-6
:neuropeptide Y umano
- Neuropeptide Y (human), 36-L-tyrosine-
- NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
- Neuropeptide Y, Human
- NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
- hnpy
- H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
- REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
- Neuropeptide Y (29-64), amide, human
- Neuropeptide Y (huMan, rat)
- hNPY, NPY
- Neuropeptide Y (Alligator mississippiensis)
- Neuropeptide Y (human, rat) Acetate
- NEUROPEPTIDE Y (HUMAN, RAT)
- Human neuropeptide Y (29-64)
- YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
- M.W. 4271.68 C189H285N55O57S
- Neuropeptide Y (rat)
- NPY (HUMAN, RAT)
- H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
- NPY FREE ACID (HUMAN, RAT)
- Neuropeptide Y (Gopherus agassizii)
- H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
- NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
- Neuropeptide Y (human pheochromocytoma)
- NPY (huMan, rat)
- TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
- Neuropeptide Y(1-36)
- Vedi altri sinonimi
Neuropeptide Y, Human
CAS:For cellular and molecular biology applicationsFormula:C189H285N55O57SPeso molecolare:4271.74Neuropeptide Y (human, rat)
CAS:Bachem ID: 4012616.
Formula:C189H285N55O57SPurezza:95.2%Colore e forma:WhitePeso molecolare:4271.74Ref: IN-DA00GRZM
5mgPrezzo su richiesta10mgPrezzo su richiesta25mgPrezzo su richiesta50mgPrezzo su richiesta1mg565,00€Neuropeptide Y (human)
CAS:Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.Formula:C189H285N55O57SPurezza:98%Colore e forma:SolidPeso molecolare:4271.68NPY (Human, Rat)
CAS:NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.Formula:C189H285N55O57SPurezza:Min. 95%Peso molecolare:4,271.7 g/molNeuropeptide Y, human
CAS:Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.
Formula:C189H285N55O57SPurezza:Min. 95%Peso molecolare:4,271.69 g/molNPY (Human, Rat)
CAS:NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.
Formula:C189H285N55O57SPurezza:Min. 95%Peso molecolare:4,271.7 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C189H285N55O57SPurezza:Min. 95%Peso molecolare:4,271.69 g/mol






