Prodotti biochimici e reagenti
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(98.560 prodotti)
- Per obiettivo biologico(101.036 prodotti)
- Per uso/effetti farmacologici(6.953 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(531 prodotti)
- Biologia vegetale(6.903 prodotti)
- Metaboliti secondari(14.369 prodotti)
Trovati 130609 prodotti di "Prodotti biochimici e reagenti"
Collagen Type IV antibody (biotin)
Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.
ELF5 antibody
The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.
9330134C04Rik Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of 9330134C04Rik antibody, catalog no. 70R-8179
Purezza:Min. 95%LHR antibody
The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.
XL 647
CAS:Inhibitor of EGFR, HER2 and VEGFR2 tyrosine kinases
Formula:C24H25Cl2FN4O2Purezza:Min. 95%Peso molecolare:491.38 g/molPAIP1 antibody
PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY
MGLL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGLL antibody, catalog no. 70R-9175
Purezza:Min. 95%NMUR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NMUR2 antibody, catalog no. 70R-1539
Purezza:Min. 95%ZNF382 antibody
ZNF382 antibody was raised in rabbit using the N terminal of ZNF382 as the immunogen
Purezza:Min. 95%SPTLC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPTLC1 antibody, catalog no. 70R-6554
Purezza:Min. 95%TM9SF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TM9SF1 antibody, catalog no. 70R-1883
Purezza:Min. 95%KCNK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-1532
Purezza:Min. 95%Interferon alpha Receptor 1 antibody
The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.
ZDHHC24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC24 antibody, catalog no. 70R-7007
Purezza:Min. 95%Factor IX antibody (biotin)
Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.
PTHLH antibody
PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
