Prodotti biochimici e reagenti

A synthetic peptide for use as a blocking control in assays to test for specificity of C4orf28 antibody, catalog no. 70R-4154

A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2K antibody, catalog no. 70R-2961

A synthetic peptide for use as a blocking control in assays to test for specificity of DRGX antibody, catalog no. 70R-8703

SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT

A synthetic peptide for use as a blocking control in assays to test for specificity of POSTN antibody, catalog no. 70R-6066

A synthetic peptide for use as a blocking control in assays to test for specificity of GCK antibody, catalog no. 70R-10324

A synthetic peptide for use as a blocking control in assays to test for specificity of EDN2 antibody, catalog no. 70R-9137

A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA3 antibody, catalog no. 70R-2371

A synthetic peptide for use as a blocking control in assays to test for specificity of Gtf2b antibody, catalog no. 70R-9577

A synthetic peptide for use as a blocking control in assays to test for specificity of Arpc4 antibody, catalog no. 70R-7971

PDLIM1 antibody was raised in rabbit using the C terminal of PDLIM1 as the immunogen

Affinity purified Rabbit polyclonal SUCLA2 antibody

CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.

Affinity purified Rabbit polyclonal RBMY1A1 antibody

TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of FIP1L1 antibody, catalog no. 70R-4866

A synthetic peptide for use as a blocking control in assays to test for specificity of GRM6 antibody, catalog no. 70R-7886

The CD70 antibody is a potent antitumor agent that has been shown to inhibit the growth of tumors by reducing microvessel density and suppressing endothelial cell growth. This monoclonal antibody specifically targets the CD70 receptor, which is overexpressed in various cancer cells. By binding to this receptor, the CD70 antibody exerts cytotoxic effects on tumor cells, leading to their destruction.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF17 antibody, catalog no. 70R-8174

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.