Prodotti biochimici e reagenti

CI-949 is a peptide that can be used as a research tool or to study the interactions of proteins. CI-949 is a strong activator of voltage-gated ion channels, and is also able to inhibit ligand binding at G protein-coupled receptors. It has been shown to bind to the extracellular domain of the erythropoietin receptor, leading to activation of downstream signaling pathways. CI-949 has been shown to have high purity and solubility in water, making it an ideal research tool for use in cell biology studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of SMC4 antibody, catalog no. 70R-5518

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM37 antibody, catalog no. 70R-2244

Camptothecin-20(S)-o-propionate is a research tool. It is an activator that binds to the receptor and induces a change in cell biology, such as ion channels. Camptothecin-20(S)-o-propionate is also a ligand that can bind to the antibody or receptor and produce a change in cell biology. Camptothecin-20(S)-o-propionate has been shown to be an inhibitor of protein interactions, which may be due to its ability to inhibit peptide bond formation. Camptothecin-20(S)-o-propionate also has been shown to have pharmacological properties.

A synthetic peptide for use as a blocking control in assays to test for specificity of CCS antibody, catalog no. 70R-10222

Purified Polyclonal PKAC alpha/beta antibody

5-[(2-chloro-6-oxo-3-piperidinyl)oxy]pentanoic acid is a peptide that belongs to the group of inhibitors. It binds to the active site of protein kinases and blocks their activity. The inhibition of protein kinases prevents phosphorylation of downstream substrates, which leads to inhibition of cellular processes such as cell growth and DNA synthesis. 5-[(2-chloro-6-oxo-3-piperidinyl)oxy]pentanoic acid is also an activator of cyclic AMP response element binding (CREB), a transcription factor that regulates gene expression in response to extracellular signals. 5-[(2-chloro-6-oxo-3-piperidinyl)oxy]pentanoic acid has been used as a research tool for investigating protein interactions and receptor activation.

Rabbit polyclonal HDAC5 antibody (Ser498)

Human IgM protein (Fc5mu) (FITC) conjugate

9-Chloro-7-(2-chlorophenyl)-5H-pyrimido(5,4-D)(2)benzazepine is an ion channel activator that can be used in research to study the function of ion channels. It binds to a specific site on the protein and activates the associated ion channel. This compound can also inhibit some types of ligand binding by interfering with the binding site on the receptor. 9-Chloro-7-(2-chlorophenyl)-5H-pyrimido(5,4-D)(2)benzazepine has high purity and is available for purchase from several suppliers.

TAK-659 HCl is a peptide that belongs to the group of activator peptides. It is a high-purity product with CAS number 1312691-41-0 and is used as a research tool for ion channels, cell biology, and pharmacology. TAK-659 HCl inhibits protein interactions by binding to the receptor or ligand. The inhibition of these interactions may result in changes in the activity of ion channels or other proteins involved in signal transduction pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A3 antibody, catalog no. 70R-7217

Rabbit polyclonal RPS13 antibody

Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

Mouse monoclonal Complement D antibody (Biotin)

Affinity purified Rabbit polyclonal HMGB4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DOK7 antibody, catalog no. 70R-10372

A synthetic peptide for use as a blocking control in assays to test for specificity of FOXN4 antibody, catalog no. 70R-8770

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM6 antibody, catalog no. 70R-1614