Prodotti biochimici e reagenti
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(98.574 prodotti)
- Per obiettivo biologico(100.726 prodotti)
- Per uso/effetti farmacologici(6.937 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(439 prodotti)
- Biologia vegetale(6.907 prodotti)
- Metaboliti secondari(14.367 prodotti)
Trovati 130493 prodotti di "Prodotti biochimici e reagenti"
Keratin hHa5 antibody
Keratin hHa5 antibody was raised in guinea pig using a synthetic peptide of human hair (trichocytic) keratin hHa5 coupled to KLH as the immunogen.
Purezza:Min. 95%FBXL3 antibody
FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV
PNMA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA3 antibody, catalog no. 70R-2050
Purezza:Min. 95%Leptin antibody (biotin)
Leptin antibody was raised in rabbit using highly pure recombinant murine leptin as the immunogen.
HDAC6 antibody
The HDAC6 antibody is a highly specific monoclonal antibody that is designed to target and neutralize the histone deacetylase 6 (HDAC6) enzyme. This antibody is derived from human serum and has been extensively tested for its efficacy in various research applications.
APBB1IP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APBB1IP antibody, catalog no. 70R-4095
Purezza:Min. 95%TMB Substrate Diluent
TMB Substrate Diluent is a versatile product used in biological research and life sciences. It is commonly used in assays involving vasoactive intestinal peptide, dopamine, necrosis factor-related apoptosis-inducing factors, activated cytotoxic cells, adipose tissue, catechol-o-methyltransferase, chimeric receptors, antibodies, and nuclear inhibitors. This diluent is specifically designed to enhance the performance of various biological reagents such as monoclonal antibodies and multidrug inhibitors. It provides optimal conditions for accurate and reliable results in experimental procedures. With its high-quality formulation and compatibility with a wide range of applications, TMB Substrate Diluent is an essential tool for researchers in the field of life sciences.Purezza:Min. 95%CYP2E1 antibody
CYP2E1 antibody was raised in rabbit using a synthetic peptide as the immunogen.
Purezza:Min. 95%VZV ORF9 protein
VZV ORF9 immunodominant regions containing amino acids 6-28 and 76-100.Purezza:Min. 95%ISYNA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ISYNA1 antibody, catalog no. 70R-2653
Purezza:Min. 95%Influenza A protein
The Influenza A protein is a biomolecule that plays a crucial role in the life cycle of the influenza virus. It is an antigen that can be used to stimulate an immune response and develop immunity against the virus. This recombinant protein is derived from the influenza virus and can be used in research, diagnostics, and vaccine development.Purezza:90% By Sds-PageADIPOR2 antibody
ADIPOR2 antibody was raised in rabbit using the N terminal of ADIPOR2 as the immunogen
ROPN1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ROPN1L antibody, catalog no. 70R-10112
Purezza:Min. 95%ATP8B2 antibody
ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
