Prodotti biochimici e reagenti

Purified native Influenza A H1N1 protein (Taiwan)

A synthetic peptide for use as a blocking control in assays to test for specificity of FZD9 antibody, catalog no. 70R-1552

CD2, human, recombinant is a research peptide that is commonly used in scientific studies. It is a protein that is produced using Escherichia Coli bacteria. CD2 plays an important role in immune responses and cell signaling. This recombinant form of CD2 allows researchers to study its function and interactions with other molecules in a controlled laboratory setting. It can be used in various experiments and assays to investigate the mechanisms of immune system regulation and develop potential therapeutic interventions. With its high purity and quality, CD2, human, recombinant is a valuable tool for researchers in the field of immunology and molecular biology.

Purified recombinant Human RGS14 protein (His tag)

BAY8040 is a research tool that has been shown to activate receptors and ion channels. It binds to cell surfaces and can be used in the study of protein interactions. BAY8040 is a ligand that binds to the receptor, which is an enzyme found on the surface of cells. BAY8040 can also be used as a pharmacological agent for the treatment of high blood pressure, inflammation, or pain.

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A13 antibody, catalog no. 70R-1870

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF11 antibody, catalog no. 70R-6403

Region of SDF1 protein corresponding to amino acids KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKSNNRQVC IDPKLKWIQE YLDKALNKRL KM.

Il-4 is a cytokine that plays an important role in the immune system. Il-4 inhibitor is a research tool that can be used to study the function of this cytokine. It has been shown to activate and bind to the IL-4 receptor, which is found on many cells, including eosinophils, basophils, monocytes, and lymphocytes. Il-4 inhibitor binds to these receptors as a ligand while inhibiting the effects of IL-4 by binding to its receptor. The IL-4 inhibitor also inhibits the activity of certain ion channels and prevents high levels of calcium ions from entering cells. The il-4 inhibitor has been shown to inhibit protein interactions and interfere with peptide synthesis. This compound is CAS No. 1332184-63-0 and can be used for life science research or pharmacology studies.

WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.

ELISA kit for the detection of Human GCSF in the research laboratory

Rabbit polyclonal GPR123 antibody

Purified native Human S100 beta beta and alpha beta S100 protein (homo/heterodimer)

A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT8 antibody, catalog no. 70R-1263

Pasireotide pamoate is a peptide that is known to interact with ion channels, receptors, and ligands. It has been shown to activate some of these proteins and inhibit others. Pasireotide pamoate can be used as a research tool in the study of protein interactions, especially those that are involved in cell biology. Pasireotide pamoate binds to antibodies and has been shown to inhibit the activity of certain enzymes. It is also an inhibitor of cellular activation at high concentrations.

ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.

A synthetic peptide for use as a blocking control in assays to test for specificity of C13ORF8 antibody, catalog no. 20R-1070

A synthetic peptide for use as a blocking control in assays to test for specificity of PFAS antibody, catalog no. 70R-2690