Prodotti biochimici e reagenti
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(98.569 prodotti)
- Per obiettivo biologico(100.669 prodotti)
- Per uso/effetti farmacologici(6.934 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(369 prodotti)
- Biologia vegetale(6.908 prodotti)
- Metaboliti secondari(14.364 prodotti)
Trovati 130473 prodotti di "Prodotti biochimici e reagenti"
SLC25A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A1 antibody, catalog no. 70R-6508
Purezza:Min. 95%CATSPER2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CATSPER2 antibody, catalog no. 70R-1500
Purezza:Min. 95%ADORA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA1 antibody, catalog no. 70R-9943
Purezza:Min. 95%Cytokeratin 75 antibody
Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI
Mouse IgM ELISA Kit
Please enquire for more information about Mouse IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%ID3 antibody
The ID3 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important marker for activated astrocytes in the central nervous system. This antibody plays a crucial role in various life sciences research, particularly in studying the functions and interactions of astrocytes in different physiological and pathological conditions. Additionally, the ID3 antibody has been extensively used in adipose tissue research to investigate the role of astrocytes in regulating fatty acid metabolism and adipogenesis. Its high specificity and affinity make it an invaluable tool for scientists working in these fields.Sin3b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sin3b antibody, catalog no. 70R-8194
Purezza:Min. 95%ATPIF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATPIF1 antibody, catalog no. 70R-5303
Purezza:Min. 95%RHAG antibody
RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
Human Lactoferrin ELISA Kit
Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Peptide YY antibody
Peptide YY antibody is a calcitonin-like peptide that plays a role in regulating pancreatic insulin secretion. It is an activated and stable analogue of the peptide YY hormone. This antibody has been used in various studies in Life Sciences to investigate its effects on cholinergic and thyrotropin-releasing hormone-induced insulin secretion. Peptide YY antibody has also been utilized in research involving microinjection and subthreshold dose experiments, as well as the use of antisense oligodeoxynucleotides. This polyclonal antibody binds specifically to peptide YY, allowing for the detection and analysis of this hormone in different experimental settings.
Goat anti Mouse IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purezza:Min. 95%MAN1A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAN1A2 antibody, catalog no. 70R-6984
Purezza:Min. 95%GALC antibody
GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALPurezza:Min. 95%c-Jun antibody
The c-Jun antibody is a specific monoclonal antibody that targets the polymorphic protein known as c-Jun. This antibody is widely used in the field of life sciences for research purposes. It has been shown to effectively detect and bind to c-Jun, allowing for the study of its functions and interactions within cells.
Purezza:Min. 95%
