Prodotti biochimici e reagenti

MAL-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2B antibody, catalog no. 70R-10149

Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

Pdk4-in-1 hydrochloride is a peptide that has been shown to activate the erythropoietin receptor. It is an inhibitor of protein interactions and can be used as a research tool for studying the effects of peptides on ion channels, cell biology, and pharmacology. Pdk4-in-1 hydrochloride has also been shown to inhibit the activity of various receptors, including the erythropoietin receptor (EPOR) and lysophosphatidic acid receptors. This peptide can be used as a ligand to investigate the interactions between proteins in cells.

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A12 antibody, catalog no. 70R-7371

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SERTAD2 antibody, catalog no. 70R-9093

Affinity purified Rabbit polyclonal TNFAP1 antibody

Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rat Beta 2-Microglobulin ELISA Kit
Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.

2-Amino-N-(4-(5-oxo-7-(piperazin-1-yl)-5H-[1,3,4]thiadiazolo[3,2-a]pyrimidin-2-yl)pyridin-2-yl)acetamide is a ligand that is used in research and cell biology. It binds to the G protein coupled receptor and activates it by increasing the intracellular concentration of cyclic AMP. 2mmol/L of this ligand can activate the receptor. This compound also inhibits ion channels such as potassium channels and calcium channels. The pharmacology of this compound has been well studied in relation to its ability to inhibit certain enzymes such as protein kinase C and phosphoinositide 3 kinase (PI3K).

Please enquire for more information about 1-(3-Azido-3-phenylpropoxy)naphthalene including the price, delivery time and more detailed product information at the technical inquiry form on this page

18:0(2S-OH) ceramide is a synthetic, water-soluble, and non-toxic inhibitor of the anion channels. It is a potent activator of the neuronal nicotinic receptor and is used in pharmacology and cell biology research as a ligand for detecting protein interactions. 18:0(2S-OH) ceramide has been shown to inhibit the ion channels that are activated by voltage or calcium ions. This inhibition can be reversed by increasing membrane potentials or blocking calcium channels. 18:0(2S-OH) ceramide also binds to the receptor sites of proteins such as peptides, antibodies, and other ligands.
18:0(2S-OH)ceramide does not have any adverse effects on human health and is not toxic at high doses.

IL6 antibody is an antibody preparation that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory and immune responses. IL-6 plays a critical role in the regulation of hepcidin, an antimicrobial peptide that controls iron metabolism. By neutralizing IL-6, this antibody can modulate hepcidin levels and potentially impact iron homeostasis.

N-(1-(Dimethylamino)-1-oxopropan-2-yl)-4-((2-oxo-2,3-dihydro-1H-benzo[D]imidazole)-5-sulfonamido)benzamide is a potent and selective inhibitor of the human EP4 receptor. It has been shown to inhibit the binding of several different classes of ligands to the EP4 receptor with IC50 values ranging from 2 nM to 10 μM. This compound is also an agonist at the EP4 receptor with EC50 values in the low nanomolar range. N-(1-(Dimethylamino)-1-oxopropan-2-yl)-4-(2-(dimethylamino)ethoxy)benzamide has been used as a research tool for studying protein interactions and for identifying new protein interactions. It is also used as a high purity reagent for cell biology and life

GS 9973 is a research drug that inhibits the activity of protein kinases, which are enzymes that regulate the function of other proteins. GS 9973 inhibits the activity of mcl-1, an effector protein in the apoptosis pathway and is currently being tested for its ability to inhibit cancer cells from spreading. GS 9973 has been shown to have a low risk of toxicity in humans and has been found to be safe for use in clinical trials with human pharmacokinetics. This drug also inhibits P-gp substrates, which prevents it from entering into the retina. The only side effects observed so far are eye disorders such as conjunctivitis and iritis.