Prodotti biochimici e reagenti

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.

Catalogue peptide; min. 95% purity

Full agonist of the μ-opioid receptor (MOR) with Ki of 383 nM. It also weakly agonizes the δ-opioid receptor (DOR) with a Ki >10 μM. Tianeptine has antidepressant effects but can also regulate neuroplasticity in the amygdala and stress-induced release of glutamate. It can generate analgesia and reward, typical opiate-like behavioural effects, but does not induce tolerance or withdrawal.

Hydroxybupropion is a drug that is used to treat depressive disorders. It acts as a nicotinic acetylcholine receptor antagonist and a dopamine uptake inhibitor, which increases the levels of dopamine in the brain. It is also an antidepressant with clinical response after oral administration. The plasma concentration-time curve of hydroxybupropion can be found by using both the conventional single-phase linear regression method and a nonlinear mixed effects model. This drug may interact with other drugs, such as antidepressants and antipsychotics, and has been shown to increase their levels in the blood stream. Hydroxybupropion also interacts with drugs that affect metabolism, such as α1-acid glycoprotein, or are taken up by the liver, such as acetylcholinesterase inhibitors. The chemical stability of hydroxybupropion can be determined by examining its stereoselectivity for acetylcholine receptors, which is dependent on pH.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.

nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent

Catalogue peptide; min. 95% purity

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Catalogue peptide; min. 95% purity

Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.

Catalogue peptide; min. 95% purity