Prodotti biochimici e reagenti

CAS No. 117592-45-7 is an ion channel activator that belongs to the group of peptides. It is a high purity product with a purity of 99.5% and has been purified by HPLC. CAS No. 117592-45-7 activates voltage-gated sodium channels in neuronal tissue, which may be due to its ability to bind to the receptor site and activate it, or by binding to the protein and changing its conformation to allow ions through the channel pore. The specificity of this ligand has been shown using antibody inhibition assays on rat erythrocytes and human erythrocytes.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.

Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Z-Phe-Val-OH is an optical isomer of the molecule Z-Val-OH. It can be synthesized from the reactants Isobutyl, Chloroformate, and Hydrophobic. This synthetic product has been shown to have high yields and specificities. The chiral center in this molecule causes it to rotate light in one direction or another, which means that it can be used to create a spectrum of colors. The synthesis of this molecule takes place in a kinetically controlled manner. When mixed with amines, carboxylic acids, and tripeptides, this compound will form a tripeptide bond with two amino acids on either side of the peptide chain.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Amyloid beta protein is a peptide that is a major component of the amyloid plaques found in the brain of patients with Alzheimer's disease. Amyloid beta protein (Aβ) has been shown to form fibers and fibrils, which are aggregates of polymerized Aβ peptides. These fibrils can be imaged using a fluorescent dye called dansyl. The dansyl-labeled Aβ fibrils have been shown to have a morphology similar to that seen in electron micrographs of amyloid plaques. The quantum yield for luminescence was found to be 0.1% for the Aβ fibrils but only 0.001% for the monomeric form of Aβ peptides (Aβ 1-40). This suggests that the Aβ peptides are undergoing aggregation into amyloid beta protein fibrils before they can emit light as fluorescence or phosphorescence.