Prodotti biochimici e reagenti

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>hCG antibody was raised in goat using highly pure immuno grade hCG as the immunogen.</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>Purified recombinant SIV mac251 Rev protein</p>

<p>hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal REV (HIV-1 HxB2, HxB3) antibody (FITC)</p>

<p>Mouse monoclonal CD8 antibody (FITC); concentration 1 mg/ml</p>

<p>Mouse monoclonal HIV2 gp105 antibody (FITC)</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>Purified recombinant p17 Treponema Pallidum protein</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>hCG Alpha antibody was raised in goat using Alpha subunit of HCG as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Mouse monoclonal HIV2 p26 antibody (HRP)</p>

<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication processes. Extensive research has demonstrated its efficacy using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>

<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Purified recombinant HIV2 RT ROD protein</p>

<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>

<p>Ketoconazole is a versatile powder that has neutralizing properties and can be used in various applications in the Life Sciences field. It is commonly used as a growth factor in Biological Reagents, where it promotes the growth and development of cells. Additionally, ketoconazole is known for its ability to interact with antibodies, including monoclonal antibodies and trifunctional antibodies, enhancing their effectiveness.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>SIV mac251 p28 antibody was raised in rabbit using full length recombinant p28 (SIVmac251) as the immunogen.</p>

<p>Cocaine antibody was raised in goat using cocaine-KLH as the immunogen.</p>

<p>Microtubule-stabilizing agent; antineoplastic;</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>Filamentous Hemagglutinin purified from Bordetella Pertussis</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>The HRP2 antibody is an immobilized monoclonal antibody used in Life Sciences. It is specifically designed to target interferon-gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody can be used for various applications, including the detection and quantification of IFN-gamma in biological samples. Additionally, the HRP2 antibody has been shown to bind to virus surface antigens, insulin-like growth factors, fatty acids, and hormone peptides. Its high specificity and affinity make it a valuable tool in research and diagnostics. Furthermore, this antibody has also been demonstrated to be effective against alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. With its versatility and wide range of applications, the HRP2 antibody is an essential component for any laboratory working in the field of immunology and molecular biology.</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (HRP)</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Lipase protein is a crucial component in the breakdown of fats and plays a significant role in various biological processes. It acts as an enzyme that catalyzes the hydrolysis of triacylglycerols into fatty acids and glycerol. Lipase protein has been extensively studied for its involvement in adipose tissue metabolism, where it helps mobilize stored fats for energy production.</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>Rabbit anti Goat IgG antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>Plasmodium Falciparum MSP1 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Plasmodium Falciparum MSP1 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal Human Complement C1s antibody</p>

<p>Goat polyclonal Digoxin antibody</p>

<p>Goat polyclonal CRP antibody</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>Goat anti Mouse IgG antibody</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Polyclonal Red Blood Cell antibody</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>Goat polyclonal Human Ferritin antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Please enquire for more information about HRP Goat Anti Alpaca IgG, VHH domain HRP including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sirt7 inhibitor 97491 is an anticancer drug that works by inhibiting the activity of Sirt7, a protein that promotes tumor growth. This inhibitor has been shown to be effective in human cancer cell lines and may have potential for use in cancer therapy. The drug has been tested in Chinese hamster ovary cells and was found to induce apoptosis, or programmed cell death, in these cells. Sirt7 inhibitor 97491 is an analog of chloroquine and can also inhibit kinases, which are enzymes involved in signaling pathways that regulate cell growth and division. In addition, this inhibitor has been found to increase the effectiveness of other anticancer drugs such as artesunate. Overall, Sirt7 inhibitor 97491 is a promising new drug candidate for the treatment of cancer.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Mouse monoclonal HIV1 tat antibody (biotin)</p>

<p>Digoxin antibody was raised in rabbit using digoxin-BSA as the immunogen.</p>

<p>Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp26 antibody</p>

<p>ELISA kit for detection of IFN Alpha in the research laboratory</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>The CD4 protein is a glycoprotein that plays a crucial role in the immune system. It is primarily found on the surface of helper T cells, which are a type of white blood cell involved in coordinating immune responses. The CD4 protein acts as a receptor for the HIV virus, allowing it to enter and infect host cells.</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45</p>

<p>Purified recombinant SIV mac251 p28 protein</p>

<p>HIV1-RT antibody (FITC) was raised in mouse using purified, full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>

<p>THC antibody was raised in rabbit using D8-THC-KLH as the immunogen.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>The HIV1 gp41 protein is a target for inhibitors in the treatment of HIV/AIDS. It plays a crucial role in viral entry into host cells by mediating fusion between the viral and cellular membranes. Inhibiting this protein can prevent viral replication and spread.</p>

<p>hCG antibody was raised in rabbit using hCG beta as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, which ultimately hampers bacterial growth. Extensive research has demonstrated its effectiveness through various techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes several transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>

<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Rabbit anti-guinea pig IgG (H+L) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (HRP)</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>Purified recombinant HIV1 rev HxB2/HxB3 (biotin)</p>

<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>Purified recombinant SIV mac251 gp28 (HRP)</p>

<p>Theophylline 8 antibody was raised in rabbit using theophylline-8 as the immunogen.</p>

<p>Purified recombinant HIV1 rev HxB2/HxB3 (FITC)</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Goat anti Mouse IgG (H + L) secondary antibody (HRP)</p>

<p>ELISA kit for the detection of dsDNA IgG in the research laboratory</p>

<p>HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Rabbit polyclonal SIV mac251 gp120 antibody (FITC); full SIV1 mac251 gp120 immunogen</p>

<p>Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.</p>

<p>Recombinant Chikungunya Wild-Type E2/E1 Chimeric Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Chikungunya Wild-Type E2/E1 Chimeric Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (Biotin)</p>

<p>Purified recombinant HIV-1 p17 IIIB (FITC)</p>

<p>HIV1 p24 antibody (FITC) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Purified recombinant HIV2 gp36 ROD (HRP)</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Human IgG protein is a purified immunoglobulin that plays a crucial role in the immune system. It is widely used in life sciences research and various industrial applications. Human IgG protein has been extensively studied through molecular modeling, revealing its complex structure and functions.</p>

<p>Dilantin antibody was raised in goat using phenytoin-BSA as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Peptide H-YALYDATYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>SK channel blocker</p>

<p>Peptide H-CPSSHSSLTERHKILHRLLQEGSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VFSNGADLSGVTEEAPLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The SLC12 family consists of nine member proteins, SLCA1 through to SLC12A9. Solute Carrier Family 12 Member 2 (SLC12A2) encodes a protein used in mediating the cotransport and reabsorption of Na+, K+ and 2Cl- ions (NKCC), it is a membrane-bound symporter channel needed for both epithelial absorption and secretion of ions. SLC12A2 spans the membrane and is necessary in maintaining ionic balance, cell volume and overall homeostasis of a cell.SLC12A2 is shown to be involved in neurodevelopment, specifically in the cortex, and is associated with neurodevelopmental disorders, with SLC12A2 mutation rate being significantly higher in individuals with neurodevelopmental issues. Additionally, mutations in SLC12A2 have been shown to cause issues with sensorineural pathways, causing hearing loss and deafness. Research into SLC12A2 and the SLC12 family as a whole could be beneficial in finding treatments for these complex neuronal issues.</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>

<p>Goat polyclonal Globulin antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Peptide H-YYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat polyclonal cAMP antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Rabbit Polyclonal Phosphotyrosine antibody</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Anti-Human VISTA Monoclonal Antibody</p>

<p>Goat polyclonal Whole Human Serum antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal PF4 antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Protected amino acid</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat anti Human IgM antibody</p>