Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(740 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75512 prodotti di "Anticorpi primari "
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a polyclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays.
SLC11A1 antibody
SLC11A1 antibody was raised using the C terminal of SLC11A1 corresponding to a region with amino acids VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT
SHC3 antibody
SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST
Goat anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purezza:Min. 95%uPAR antibody
The uPAR antibody is a monoclonal antibody that has cytotoxic properties and is used as a medicament in multidrug therapy. It targets the plasminogen activator receptor (uPAR) on the surface of cells, inhibiting its function and preventing the activation of collagen-degrading enzymes such as urokinase plasminogen activator (uPA). This antibody has been shown to be effective in treating various diseases and conditions, including cancer, thrombocytopenia, and alpha-fetoprotein-related disorders. In the field of Life Sciences, uPAR antibodies are widely used for research purposes, such as studying cell signaling pathways and growth factors. Whether you need a polyclonal or monoclonal antibody, our high-quality uPAR antibodies are designed to meet your specific research needs.
Strongzyme Goat anti Rabbit IgG (H + L) (HRP)
Strongzyme Goat anti Rabbit IgG (H + L) secondary antibody (HRP)
Purezza:Min. 95%UST antibody
UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
Flag Tag antibody
The Flag Tag antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to the Flag epitope, which is a small peptide sequence commonly added to proteins for detection and purification purposes. This antibody has been extensively validated for use in various applications such as immunoassays, Western blotting, immunofluorescence, and flow cytometry. One of the key advantages of the Flag Tag antibody is its high affinity and specificity towards the Flag epitope. This ensures reliable and accurate detection of proteins carrying this tag. Additionally, the antibody exhibits minimal cross-reactivity with other commonly used tags, making it an ideal choice for researchers working with multiple protein expression systems. In addition to its exceptional performance in protein detection, the Flag Tag antibody also offers excellent stability and reproducibility. It can withstand harsh experimental conditions such as high temperatures or denaturing agents without compromising its binding efficiency. This makes it suitable for a wide range
Salmonella antibody
Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.
