Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(740 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75512 prodotti di "Anticorpi primari "
ZNF764 antibody
ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen
Purezza:Min. 95%POLK antibody
POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ
Purezza:Min. 95%IL1RL1 antibody
The IL1RL1 antibody is a medicament that belongs to the class of polyclonal and monoclonal antibodies. It is cytotoxic and specifically targets the TNF-related apoptosis-inducing ligand (TRAIL) receptor 1 (IL1RL1). This antibody can be used for therapeutic purposes in various diseases where TRAIL signaling is involved, such as cancer. The IL1RL1 antibody binds to IL1RL1 on the surface of cells and induces cell death by activating apoptotic pathways. It has been shown to inhibit the growth and proliferation of cells expressing IL1RL1, making it a potential treatment option for certain types of cancer. Additionally, this antibody has been used in research studies to investigate the role of IL1RL1 in various biological processes.Purezza:Min. 95%CBG antibody
The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.
BPGM antibody
The BPGM antibody is a powerful tool used in chemotherapy and various Life Sciences research applications. It belongs to the class of antibodies that specifically target BPGM (bisphosphoglycerate mutase), an enzyme involved in the metabolism of glucose. This antibody has high affinity for BPGM and can be used in various assays to detect its presence or measure its activity.
HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
MAGEA3 antibody
MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
UCP2 antibody
UCP2 antibody was raised in rabbit using a 14 amino acid peptide from mouse UCP2 as the immunogen.Purezza:Min. 95%
