Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(740 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75459 prodotti di "Anticorpi primari "
Methylprednisolone antibody
The Methylprednisolone antibody is a monoclonal antibody that falls under the category of Life Sciences. This hormone peptide antibody specifically targets and binds to methylprednisolone, a steroid hormone. It has a glycan structure that plays a crucial role in neutralizing the effects of methylprednisolone.Purezza:Min. 95%REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurezza:Min. 95%Goat anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purezza:Min. 95%PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
CGRP antibody
CGRP antibody was raised in guinea pig using calcitonin gene-related peptide conjugated to BSA as the immunogen.Purezza:Min. 95%Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purezza:Min. 95%FKHR antibody
The FKHR antibody is a powerful growth factor and hormone peptide that plays a crucial role in various biological processes. It is commonly used in research and diagnostics to detect the presence of FKHR in samples.
Purezza:Min. 95%Strongzyme Goat anti Rabbit IgG (H + L) (HRP)
Strongzyme Goat anti Rabbit IgG (H + L) secondary antibody (HRP)
Purezza:Min. 95%POLK antibody
POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ
Purezza:Min. 95%TMEM30A antibody
TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECPurezza:Min. 95%ABCA12 antibody
ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
Purezza:Min. 95%Mouse anti Human IgM (HRP)
IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.Purezza:Min. 95%PYGO1 antibody
PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen
Purezza:Min. 95%ZNF382 antibody
ZNF382 antibody was raised in rabbit using the N terminal of ZNF382 as the immunogen
Purezza:Min. 95%GJA9 antibody
GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Purezza:Min. 95%
