Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(740 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75448 prodotti di "Anticorpi primari "
Phosphothreonine antibody (biotin)
Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.
NTR1 antibody
The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.
DGKA antibody
The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.
CD1a antibody
The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.
CD81 antibody (biotin)
CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.
Purezza:Min. 95%Ketamine antibody
Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.
TKTL1 antibody
TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
Beta tubulin antibody
The Beta tubulin antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to target and bind to beta tubulin, a protein involved in cell division and intracellular transport. This antibody plays a crucial role in various research applications, including the study of amyloid plaque formation, growth factor signaling pathways, antiangiogenic therapies, and the development of inhibitors such as taxol.
ZFP36 antibody
The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.
PELI1 antibody
The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.
