CymitQuimica logo
Anticorpi primari

Anticorpi primari

Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.

Sottocategorie di "Anticorpi primari "

Mostrare 1 più sottocategorie

Trovati 75448 prodotti di "Anticorpi primari "

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • Phosphothreonine antibody (biotin)


    Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.

    Ref: 3D-60R-PR002BT

    ne
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • NTR1 antibody


    The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.

    Ref: 3D-70R-31003

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • PSMB9 antibody


    Rabbit polyclonal PSMB9 antibody

    Ref: 3D-70R-19590

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • DGKA antibody


    The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.

    Ref: 3D-10R-3825

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • CD1a antibody


    The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.

    Ref: 3D-10R-6325

    25µg
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • PPP1R11 antibody (FITC)


    Rabbit polyclonal PPP1R11 antibody (FITC)

    Ref: 3D-60R-1213

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • CD81 antibody (biotin)


    CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

    Purezza:Min. 95%

    Ref: 3D-61R-CD81BT

    500µg
    Fuori produzione
    Prodotto fuori produzione
  • Ketamine antibody


    Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.

    Ref: 3D-70-1093

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • Lipoic acid synthetase antibody


    Affinity purified Rabbit polyclonal Lipoic acid synthetase antibody

    Ref: 3D-70R-13648

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • CD3G antibody


    CD3G antibody was raised in Rabbit using Human CD3G as the immunogen

    Ref: 3D-70R-16274

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • RASD2 antibody


    Rabbit polyclonal RASD2 antibody

    Ref: 3D-70R-32069

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • COL6A2 antibody


    COL6A2 antibody was raised in Rabbit using Human COL6A2 as the immunogen

    Ref: 3D-70R-16504

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • TKTL1 antibody


    TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

    Ref: 3D-70R-2668

    1u
    Fuori produzione
    100µl
    Fuori produzione
    Prodotto fuori produzione
  • NDUFA12 antibody


    NDUFA12 antibody was raised in Rabbit using Human NDUFA12 as the immunogen

    Ref: 3D-70R-18798

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • Beta tubulin antibody


    The Beta tubulin antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to target and bind to beta tubulin, a protein involved in cell division and intracellular transport. This antibody plays a crucial role in various research applications, including the study of amyloid plaque formation, growth factor signaling pathways, antiangiogenic therapies, and the development of inhibitors such as taxol.

    Ref: 3D-10R-10449

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • ATP8A1 antibody


    ATP8A1 antibody was raised in Rabbit using Human ATP8A1 as the immunogen

    Ref: 3D-70R-15927

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • ZFP36 antibody


    The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.

    Ref: 3D-70R-21379

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • PELI1 antibody


    The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.

    Ref: 3D-70R-19210

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • c-Cbl antibody


    Rabbit polyclonal c-Cbl antibody

    Purezza:Min. 95%

    Ref: 3D-20R-2175

    1u
    Fuori produzione
    50µg
    Fuori produzione
    Prodotto fuori produzione
  • IMMP2L antibody


    IMMP2L antibody was raised in Rabbit using Human IMMP2L as the immunogen

    Ref: 3D-70R-17961

    50µl
    Fuori produzione
    Prodotto fuori produzione