Anticorpi primari

<p>MAP126 antibody was raised in rabbit using human MAP126 protein as the immunogen.</p>

<p>FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>The mTOR antibody is a highly specialized monoclonal antibody that targets the phosphatase known as mammalian target of rapamycin (mTOR). This glycoprotein plays a crucial role in regulating cell growth, proliferation, and survival. By specifically binding to mTOR, this antibody inhibits its activity and disrupts downstream signaling pathways involved in cell cycle progression and protein synthesis.</p>

<p>DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED</p>

<p>ZMYND17 antibody was raised in rabbit using the C terminal of ZMYND17 as the immunogen</p>

<p>Rabbit polyclonal Girdin antibody (Ser1417)</p>

<p>TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC</p>

<p>C10ORF46 antibody was raised using the middle region of C10Orf46 corresponding to a region with amino acids SELSEYAAQDQKFQRELIQNGFTRGDQSRKRAGDELAYNSSSACASSRGY</p>

<p>The Cyclin D1 antibody is a highly specialized Polyclonal Antibody used in immunoassays within the Life Sciences field. It specifically targets endothelial growth factors, such as fibronectin and collagen, to provide accurate and reliable results. This antibody is available in both polyclonal and monoclonal forms, giving researchers the flexibility to choose the best option for their experiments.</p>

<p>MXI1 antibody was raised in mouse using recombinant Human Max Interactor 1</p>

<p>The LATS antibody is a polyclonal antibody that is used in life sciences research. It specifically targets alpha-fetoprotein, telomerase, chemokines, brain natriuretic peptide, and growth factor-1 receptor. This antibody is widely used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to be highly specific and sensitive in detecting its target proteins in human serum samples. The LATS antibody can be used to study the role of these proteins in various physiological processes and diseases. With its high-quality performance and reliable results, this antibody is an essential tool for researchers in the field of life sciences.</p>

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>Ankrd13d antibody was raised in rabbit using the middle region of Ankrd13d as the immunogen</p>

<p>RP13-102H20.1 antibody was raised using the middle region of RP13-102H20.1 corresponding to a region with amino acids EDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGA</p>

<p>Purified Polyclonal CK1 gamma 2 antibody</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>