CymitQuimica logo
Anticorpi primari

Anticorpi primari

Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.

Sottocategorie di "Anticorpi primari "

Mostrare 1 più sottocategorie

Trovati 75323 prodotti di "Anticorpi primari "

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • ARSA antibody


    <p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

    Ref: 3D-70R-2332

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • TEK antibody


    <p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

    Ref: 3D-70R-20759

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • Mouse Isotyping Kit


    <p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>
    Purezza:Min. 95%

    Ref: 3D-55-1244

    ne
    Fuori produzione
    1piece
    Fuori produzione
    Prodotto fuori produzione