Anticorpi primari
Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.624 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(736 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Mostrare 1 più sottocategorie
Trovati 75324 prodotti di "Anticorpi primari "
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>LDHC antibody
<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>ARSA antibody
<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>anti-Human Troponin I Monoclonal Antibody
<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>Purezza:Min. 95%Alirocumab
CAS:<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>Purezza:Min. 95%Colore e forma:LiquidMyeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>ACTL7B antibody
<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>MPS1 antibody
<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>TFCP2 antibody
<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>ITGA6 antibody
<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>
