Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(739 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75447 prodotti di "Anticorpi primari "
Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purezza:Min. 95%GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
PCIP antibody
The PCIP antibody is a highly specialized monoclonal antibody that targets the fas-mediated apoptosis pathway. It has been extensively studied in adipose tissue and has shown cytotoxic effects on cells expressing high levels of interleukin-6 (IL-6) and growth factor receptors. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell signaling and regulation of gene expression. It has also been shown to interact with other monoclonal antibodies targeting collagen, erythropoietin, fibrinogen, and phosphatase. The PCIP antibody disrupts the organization of actin filaments within cells, leading to apoptosis and inhibition of cell growth.
Goat anti Monkey IgG (HRP)
Goat anti-monkey IgG (HRP) was raised in goat using monkey IgG chain as the immunogen.Somatostatin antibody
Somatostatin antibody was raised in sheep using somatostatin conjugated to carrier protein as the immunogen.
CD4 antibody
The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.
SFPQ antibody
SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR
Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purezza:Min. 95%Treponema pallidum antibody
Treponema pallidum antibody was raised in rabbit using highly purified Treponema pallidum as the immunogen.
Purezza:Min. 95%STAT3 antibody
The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.
Cofilin antibody
The Cofilin antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing chemokines, interferons, and growth factors that are activated and reactive in the body. This antibody has been shown to inhibit the activity of 3-kinase enzymes, which play a crucial role in cell growth and proliferation. Additionally, it can also bind to autoantibodies and taxol, preventing their harmful effects on the body. The Cofilin antibody has been extensively studied for its potential therapeutic applications in various diseases and conditions.
Purezza:Min. 95%
