Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(739 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75447 prodotti di "Anticorpi primari "
AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa731-909) expressed in E. coli as the immunogen.anti-Mouse C3 Antibody (FITC)
Please enquire for more information about anti-Mouse C3 Antibody (FITC) including the price, delivery time and more detailed product information at the technical inquiry form on this page
WDSUB1 antibody
WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS
DIDO1 antibody
DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen
Purezza:Min. 95%ADAM19 antibody
ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
Purezza:Min. 95%RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purezza:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purezza:Min. 95%ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purezza:Min. 95%Smpdl3a antibody
Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen
Purezza:Min. 95%KLC3 antibody
KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
