Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(739 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75447 prodotti di "Anticorpi primari "
FER antibody
The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.
PYGO1 antibody
PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen
Purezza:Min. 95%SC4MOL antibody
SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Caveolin 1 antibody
The Caveolin 1 antibody is a highly specialized monoclonal antibody that targets tyrosine residues on the Caveolin 1 protein. This protein plays a crucial role in cellular processes such as growth factor signaling and receptor internalization. By binding to Caveolin 1, this antibody inhibits its function, leading to cytotoxic effects on cancer cells.
Purezza:Min. 95%SHARPIN antibody
SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen
Purezza:Min. 95%ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
Donkey anti Guinea Pig IgG (H + L) (Cy3)
Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
Purezza:Min. 95%Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurezza:Min. 95%Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purezza:Min. 95%DGKE antibody
DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRPurezza:Min. 95%BBS5 antibody
BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
ZNF605 antibody
ZNF605 antibody was raised in rabbit using the N terminal of ZNF605 as the immunogen
Purezza:Min. 95%AKR1C1 antibody
AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.
REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
UCHL5IP antibody
UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
