CymitQuimica logo
Anticorpi primari

Anticorpi primari

Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.

Sottocategorie di "Anticorpi primari "

Mostrare 1 più sottocategorie

Trovati 75447 prodotti di "Anticorpi primari "

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • GPR18 antibody


    GPR18 antibody was raised in rabbit using the middle region of GPR18 as the immunogen

    Ref: 3D-70R-10503

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • STATH antibody


    Rabbit polyclonal STATH antibody

    Ref: 3D-70R-20578

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • Caspase 8 antibody (Ser347)


    Rabbit polyclonal Caspase 8 antibody (Ser347)

    Ref: 3D-70R-30656

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • MAP3K1 antibody (biotin)


    Rabbit polyclonal MAP3K1 antibody (biotin)

    Ref: 3D-60R-2232

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • BCOR antibody


    The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.

    Ref: 3D-70R-32296

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • SDP3 antibody (HRP)


    Rabbit polyclonal SDP3 antibody (HRP)

    Ref: 3D-60R-1927

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • B7H4 antibody


    The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.

    Ref: 3D-10R-6582

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • WFDC1 antibody


    WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

    Ref: 3D-70R-3978

    1u
    Fuori produzione
    100µl
    Fuori produzione
    Prodotto fuori produzione
  • ZDHHC17 antibody


    ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

    Ref: 3D-70R-1832

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • Moesin antibody


    Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.

    Ref: 3D-10R-10353

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • PLA2G4F antibody


    Rabbit polyclonal PLA2G4F antibody

    Ref: 3D-70R-19327

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • VIM antibody


    The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.

    Ref: 3D-70R-21254

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • SH2D2A antibody


    Mouse monoclonal SH2D2A antibody

    Ref: 3D-10R-7183

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • LZTFL1 antibody


    LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

    Ref: 3D-70R-1291

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • TIA1 antibody


    Rabbit polyclonal TIA1 antibody

    Ref: 3D-70R-20819

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • CD71 antibody


    CD71 antibody was raised in rat using CD71/transferrin receptor as the immunogen.

    Ref: 3D-10R-CD71CMS

    500µg
    Fuori produzione
    Prodotto fuori produzione
  • 14-3-3 zeta/theta antibody


    Rabbit polyclonal 14-3-3 zeta/theta antibody

    Ref: 3D-70R-33344

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • XRCC4 antibody


    The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.

    Ref: 3D-10R-6300

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • ATF2 antibody


    The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.

    Ref: 3D-70R-37470

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • GTPBP2 antibody


    GTPBP2 antibody was raised using the C terminal of GTPBP2 corresponding to a region with amino acids VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL

    Ref: 3D-70R-1268

    100µl
    Fuori produzione
    Prodotto fuori produzione