Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75562 prodotti di "Anticorpi primari "
TIPIN antibody
TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen
Purezza:Min. 95%MMP16 antibody
The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.
SLC25A14 antibody
SLC25A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
Helicobacter pylori antibody (CagA protein)
Mouse monoclonal CagA protein antibody (Helicobacter pylori)VAX2 antibody
VAX2 antibody was raised in mouse using recombinant Human Ventral Anterior Homeobox 2 (Vax2)
TRPM4 antibody
The TRPM4 antibody is a highly specialized antibody used in the field of life sciences. It is specifically designed to target and neutralize the TRPM4 protein, which plays a crucial role in cellular processes such as calcium signaling and ion transport. This monoclonal antibody has been extensively tested and proven to be highly reactive and effective in inhibiting the activity of TRPM4.
Pleiotrophin antibody
The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.
GPT antibody
GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI
