Anticorpi primari

The DDX39 antibody is a valuable tool used in immunoassays within the Life Sciences field. It specifically targets and binds to isolated nucleic acids, collagen, trastuzumab, and other important molecules. This antibody can be used in both polyclonal and monoclonal forms, allowing for versatile applications in various research settings.

NBN antibody was raised in Rabbit using Human NBN as the immunogen

EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

The WNT11 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. This antibody specifically targets the amino group and acts as a growth factor, promoting cellular development and function.

Affinity purified Rabbit polyclonal PGAM2 antibody

The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.

FMO3 antibody was raised in Rabbit using Human FMO3 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase gamma antibody

The CD40 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used in various immunoassays to detect the presence of CD40, a protein that is involved in immune responses. This antibody specifically targets CD40 and binds to it, allowing for accurate detection and quantification. The CD40 antibody has been extensively studied and proven to be highly effective in detecting CD40 in human serum samples. Additionally, it has shown promising results in inhibiting the activity of specific enzymes, such as phosphatases and fatty acids, which are involved in various cellular processes. Furthermore, this antibody has demonstrated antiviral properties by interfering with viral replication and inhibiting the growth of viruses. Overall, the CD40 antibody is a valuable tool for researchers and scientists working in the field of immunology and virology.

Rabbit polyclonal KCNC1 antibody (Ser503)

AP3M2 antibody was raised in Rabbit using Human AP3M2 as the immunogen

The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.

The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.

Rabbit polyclonal MKL1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment