Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75594 prodotti di "Anticorpi primari "
ACTH antibody
The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.
EXOC6 antibody
EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purezza:(Sec-Hplc) Min. 95 Area-%Colore e forma:Clear LiquidRef: 3D-BD165585
Prodotto fuori produzioneCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
