Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30473 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-RKKRRQRRRAPQDSQ-OH
<p>Peptide H-RKKRRQRRRAPQDSQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLPQDKEYYKVKEPGE-OH
<p>Peptide H-VLPQDKEYYKVKEPGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFTPPVQAAYQK-OH
<p>Peptide H-EFTPPVQAAYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPRAPIRPI-OH
<p>Peptide H-QPRAPIRPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WIRDS-OH
<p>Peptide H-WIRDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIVNYANL-OH
<p>Peptide H-AIVNYANL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKK-OH
<p>Peptide H-KKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPGVG-OH
<p>Peptide H-VPGVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIRPKLK-OH
<p>Peptide H-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEAQGPK-OH
<p>Peptide H-CEAQGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAPDNRETF-OH
<p>Peptide H-AAPDNRETF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASVLSGGELDRWEKI-OH
<p>Peptide H-ASVLSGGELDRWEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGDFFR-OH
<p>Peptide H-LLGDFFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPRLSHKGPMP-OH
<p>Peptide H-RPRLSHKGPMP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLSWVALFL-OH
<p>Peptide H-LLSWVALFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGMQIFVK-OH
<p>Peptide H-GGMQIFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FG-OH
<p>Peptide H-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKYNLTSVL-OH
<p>Peptide H-EKYNLTSVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAFDLSFFL-OH
<p>Peptide H-AAFDLSFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH
<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPPIPVGEIYKRWII-OH
<p>Peptide H-NPPIPVGEIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHHHHHC-OH
<p>Peptide H-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESLITLIEK-OH
<p>Peptide H-ESLITLIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQSALAAIR -OH
<p>Peptide H-VLQSALAAIR -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLYSGLNQR-OH
<p>Peptide H-DLYSGLNQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NKPQFLAGAASLLR-OH
<p>Peptide H-NKPQFLAGAASLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNENIR-OH
<p>Peptide H-LNENIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFERATVM-OH
<p>Peptide H-LPFERATVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVINSGNGAVEDR-OH
<p>Peptide H-LVINSGNGAVEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGYPVYV-OH
<p>Peptide H-LLFGYPVYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGD-OH
<p>Peptide H-DGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKLADA-OH
<p>Peptide H-RKLADA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTPTAENPEYLGLDVPV-OH
<p>Peptide H-GTPTAENPEYLGLDVPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VITAFNDGLNHLDSLK-OH
<p>Peptide H-VITAFNDGLNHLDSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH
<p>Peptide H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIDNKPSIDSYSK-OH
<p>Peptide H-IIDNKPSIDSYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHLTPEEKSAVTAL-OH
<p>Peptide H-VHLTPEEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPIYFTGLASEPGAR-OH
<p>Peptide H-DPIYFTGLASEPGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILEFVGR-OH
<p>Peptide H-ILEFVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVVGAGGVGK-OH
<p>Peptide H-LVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIDLIDEAASSIR-OH
<p>Peptide H-AIDLIDEAASSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFV-OH
<p>Peptide H-FFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEHWGLDKPLLK-OH
<p>Peptide H-VEHWGLDKPLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYSMEHFRWGKPVGKKRRPVKVYP-OH
<p>Peptide H-SYSMEHFRWGKPVGKKRRPVKVYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKRKRKRK-OH
<p>Peptide H-RKRKRKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SCSSCPLSKILLARL-OH
<p>Peptide H-SCSSCPLSKILLARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELLETVVNR-OH
<p>Peptide H-ELLETVVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAVVGVGDESR-OH
<p>Peptide H-GAVVGVGDESR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVLACY-OH
<p>Peptide H-SVLACY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAAVDLSHF-OH
<p>Peptide H-KAAVDLSHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALFYKLDVVPIDNDN-OH
<p>Peptide H-ALFYKLDVVPIDNDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-A^^A^^KIQA^^SFRGHMA^^RKK-OH
<p>Peptide LCBiot-A^^A^^KIQA^^SFRGHMA^^RKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Peso molecolare:2,151.63 g/molH-SLQPLALEGSLQKRG-OH
<p>Peptide H-SLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASQFVGSSIHWYQQR-OH
<p>Peptide H-ASQFVGSSIHWYQQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHPGGEEVLRE-OH
<p>Peptide H-EHPGGEEVLRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQTHIQQDPALPTRE-OH
<p>Peptide H-QQTHIQQDPALPTRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFIAWLVK-OH
<p>Peptide H-EFIAWLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYQVSSPIYDINYYTSE-OH
<p>Peptide H-DYQVSSPIYDINYYTSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISEGLPTPTK-OH
<p>Peptide H-ISEGLPTPTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MIAVFLPIV-OH
<p>Peptide H-MIAVFLPIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPTKDVAL-OH
<p>Peptide H-FPTKDVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLMVGGVVI-OH
<p>Peptide H-GLMVGGVVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QDIENEEKI-OH
<p>Peptide H-QDIENEEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVDNFVALATGEK-OH
<p>Peptide H-TVDNFVALATGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYVDRFFKTL-OH
<p>Peptide H-RDYVDRFFKTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSALLTPAEQTGTWK-OH
<p>Peptide H-VSALLTPAEQTGTWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLAVEEVSLRK-OH
<p>Peptide H-CLAVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTVLL-OH
<p>Peptide H-VMAPRTVLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAEKTFSVYEIMCKI-OH
<p>Peptide H-RAEKTFSVYEIMCKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYIGSINNI-OH
<p>Peptide H-SYIGSINNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTEPISAESGEQVER-OH
<p>Peptide H-VTEPISAESGEQVER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELNYFAK-OH
<p>Peptide H-ELNYFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVILLGR-OH
<p>Peptide H-SVILLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYDPVAALF-OH
<p>Peptide H-QYDPVAALF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IMQLMPFGC-OH
<p>Peptide H-IMQLMPFGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQFGPDFPTI-OH
<p>Peptide H-RQFGPDFPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPSDLNSML-OH
<p>Peptide H-TPSDLNSML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQPR-OH
<p>Peptide H-GQPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Peso molecolare:456.5 g/molH-SLFPRLYPV-OH
<p>Peptide H-SLFPRLYPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYTSFPWLL-OH
<p>Peptide H-KYTSFPWLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLLL-OH
<p>Peptide H-VMAPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDTNYCFSSTEK-OH
<p>Peptide H-ALDTNYCFSSTEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HNKHLPSTQPLA-OH
<p>Peptide H-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIRLRPGGK-OH
<p>Peptide H-KIRLRPGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIQSLEVIGK-OH
<p>Peptide H-NIQSLEVIGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFYTPKTRREAED-OH
<p>Peptide H-FFYTPKTRREAED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGYSGIFSVEGK-OH
<p>Peptide H-SGYSGIFSVEGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDSTDPPHYEETSFGDEAQNRLKC-OH
<p>Peptide H-SDSTDPPHYEETSFGDEAQNRLKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAY-OH
<p>Peptide H-ARTKQTARKSTGGKAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVAVYADQAK-OH
<p>Peptide H-AVAVYADQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPRWYFYYL-OH
<p>Peptide H-LPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-INFDFNTI-OH
<p>Peptide H-INFDFNTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSKHTPINL-OH
<p>Peptide H-YSKHTPINL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNQLLR-OH
<p>Peptide H-YNQLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEWTSSNVMEERKIKV-OH
<p>Peptide H-TEWTSSNVMEERKIKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLVQPGGSL-OH
<p>Peptide H-GLVQPGGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLCLRPVGA-OH
<p>Peptide H-VLCLRPVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CQNKESASKQS-OH
<p>Peptide H-CQNKESASKQS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNGPVKV-OH
<p>Peptide H-SNGPVKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HILPLTNDAER-OH
<p>Peptide H-HILPLTNDAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
