Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
Desmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SPeso molecolare:3,103.54 g/molRef: 3D-VAC-00617
Prodotto fuori produzioneFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Peso molecolare:359.43 g/molRef: 3D-VAC-00050
Prodotto fuori produzioneAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H63N15O13Purezza:Min. 95%Peso molecolare:1,082.13 g/molRef: 3D-FA110993
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzioneFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purezza:Min. 95%Peso molecolare:878.85 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Peso molecolare:1,078.25 g/molRef: 3D-VAC-00277
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzioneAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Peso molecolare:1,715.91 g/molRef: 3D-VAC-00251
Prodotto fuori produzioneRef: 3D-VAC-00507
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SPeso molecolare:6,220.84 g/molRef: 3D-VAC-00238
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzioneAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formula:C50H72N13O15PPeso molecolare:1,126.20 g/molRef: 3D-VAC-00342
Prodotto fuori produzionegp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formula:C135H221N45O33Peso molecolare:3,002.55 g/molRef: 3D-VAC-00900
Prodotto fuori produzione[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formula:C143H226N38O39SPeso molecolare:3,133.71 g/molRef: 3D-VAC-00202
Prodotto fuori produzionebeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzioneAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formula:C90H136N22O28S2Peso molecolare:2,038.34 g/molRef: 3D-VAC-00367
Prodotto fuori produzione[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Peso molecolare:2,167.52 g/molRef: 3D-VAC-00658
Prodotto fuori produzione[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formula:C40H72N12O13Peso molecolare:929.09 g/molRef: 3D-VAC-00451
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzionebeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formula:C133H204N34O37SPeso molecolare:2,903.38 g/molRef: 3D-VAC-00863
Prodotto fuori produzioneAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Peso molecolare:5,971.67 g/molRef: 3D-VAC-00918
Prodotto fuori produzioneSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Peso molecolare:523.55 g/molRef: 3D-VAC-00640
Prodotto fuori produzioneVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Peso molecolare:2,573.99 g/molRef: 3D-VAC-00288
Prodotto fuori produzioneGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formula:C194H318N62O62SPeso molecolare:4,543.14 g/molRef: 3D-VAC-00847
Prodotto fuori produzione[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SPeso molecolare:3,710.26 g/molRef: 3D-VAC-00470
Prodotto fuori produzioneSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzioneInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Peso molecolare:1,622.77 g/molRef: 3D-VAC-00774
Prodotto fuori produzioneFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Formula:C123H195N31O39Peso molecolare:2,732.04 g/molRef: 3D-VAC-00324
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
