Peptidi
Sottocategorie di "Peptidi"
Trovati 29773 prodotti di "Peptidi"
[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Formula:C58H77N13O10Peso molecolare:1,116.34 g/molRef: 3D-VAC-00148
Prodotto fuori produzioneBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formula:C149H224N44O45SPeso molecolare:3,383.78 g/molRef: 3D-VAC-00093
Prodotto fuori produzionegp100 (178-187)
Catalogue peptide; min. 95% purity
Formula:C42H71N11O14S2Peso molecolare:1,018.23 g/molRef: 3D-VAC-00605
Prodotto fuori produzioneIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Peso molecolare:5,102.84 g/molRef: 3D-VAC-00769
Prodotto fuori produzioneCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-BC183139
Prodotto fuori produzioneAntioxidant peptide A
Catalogue peptide; min. 95% purity
Formula:C31H54N12O7S2Peso molecolare:770.97 g/molRef: 3D-VAC-00627
Prodotto fuori produzioneSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formula:C61H105N23O21SPeso molecolare:1,528.72 g/molRef: 3D-VAC-00704
Prodotto fuori produzionebeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formula:C56H76N16O22Peso molecolare:1,325.32 g/molRef: 3D-VAC-00308
Prodotto fuori produzioneDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Peso molecolare:1,524.72 g/molRef: 3D-VAC-00577
Prodotto fuori produzione[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formula:C175H272N54O59S6Peso molecolare:4,268.78 g/molRef: 3D-VAC-00243
Prodotto fuori produzioneRef: 3D-VAC-00884
Prodotto fuori produzioneCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Peso molecolare:2,631.93 g/molRef: 3D-VAC-00613
Prodotto fuori produzioneCalcitonin (8-32) (salmon I)
Catalogue peptide; min. 95% purity
Formula:C119H198N36O37Peso molecolare:2,725.06 g/molRef: 3D-VAC-00802
Prodotto fuori produzione[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Peso molecolare:1,260.47 g/molRef: 3D-VAC-00511
Prodotto fuori produzioneBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Peso molecolare:1,441.62 g/molRef: 3D-VAC-00371
Prodotto fuori produzione[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formula:C63H103N25O19Peso molecolare:1,514.68 g/molRef: 3D-VAC-00679
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzioneBTK derived peptide
Catalogue peptide; min. 95% purity
Formula:C72H115N17O18S2Peso molecolare:1,570.95 g/molRef: 3D-VAC-00536
Prodotto fuori produzioneGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molRef: 3D-VAC-00803
Prodotto fuori produzioneRef: 3D-VAC-00916
Prodotto fuori produzioneFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111733
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneRef: 3D-VAC-00798
Prodotto fuori produzioneBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formula:C82H122N22O25SPeso molecolare:1,848.08 g/molRef: 3D-VAC-00123
Prodotto fuori produzioneAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formula:C61H94N18O16Peso molecolare:1,335.5 g/molRef: 3D-VAC-00247
Prodotto fuori produzionerec IFN-gamma (human)
CAS:Prodotto controllatoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Z-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formula:C33H44N10O7•(HCl)xPurezza:Min. 95%Peso molecolare:692.77 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Peso molecolare:1,622.77 g/molRef: 3D-VAC-00774
Prodotto fuori produzioneAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Peso molecolare:1,715.91 g/molRef: 3D-VAC-00251
Prodotto fuori produzioneHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formula:C46H75N9O11S2Peso molecolare:994.28 g/molRef: 3D-VAC-00233
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formula:C46H68N10O14SPeso molecolare:1,017.17 g/molRef: 3D-VAC-00783
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneDesmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Peso molecolare:902.02 g/molRef: 3D-VAC-00263
Prodotto fuori produzionepp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C66H109N23O23Peso molecolare:1,592.74 g/molRef: 3D-VAC-00687
Prodotto fuori produzioneBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Peso molecolare:3,552.17 g/molRef: 3D-VAC-00097
Prodotto fuori produzioneHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Peso molecolare:2,570 g/molRef: 3D-VAC-00241
Prodotto fuori produzioneRef: 3D-VAC-00750
Prodotto fuori produzione[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00912
Prodotto fuori produzioneRef: 3D-VAC-00856
Prodotto fuori produzionePGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SPeso molecolare:1,464.75 g/molRef: 3D-VAC-00045
Prodotto fuori produzioneAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formula:C86H119N23O23Peso molecolare:1,843.05 g/molRef: 3D-VAC-00471
Prodotto fuori produzioneTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Peso molecolare:1,078.25 g/molRef: 3D-VAC-00277
Prodotto fuori produzione2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Peso molecolare:937.08 g/molRef: 3D-VAC-00048
Prodotto fuori produzioneIntermedin (rat)
Catalogue peptide; min. 95% purity
Formula:C226H361N75O64S2Peso molecolare:5,216.99 g/molRef: 3D-VAC-00626
Prodotto fuori produzioneBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Peso molecolare:2,325.82 g/molRef: 3D-VAC-00086
Prodotto fuori produzioneRef: 3D-VAC-00224
Prodotto fuori produzioneBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/molRef: 3D-VAC-00065
Prodotto fuori produzioneRef: 3D-VAC-00171
Prodotto fuori produzioneTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purezza:Min. 95%Peso molecolare:1,765.06 g/molRef: 3D-FT109022
Prodotto fuori produzioneRef: 3D-VAC-00664
Prodotto fuori produzionePalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurezza:Min. 95%Peso molecolare:910.46 g/molRef: 3D-FP107899
Prodotto fuori produzione[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Peso molecolare:3,555.01 g/molRef: 3D-VAC-00488
Prodotto fuori produzioneDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formula:C27H48N8O7S3Purezza:Min 95%Peso molecolare:692.92 g/molRef: 3D-CRB7108314
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzione[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formula:C59H91N11O15Peso molecolare:1,194.45 g/molRef: 3D-VAC-00894
Prodotto fuori produzione[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formula:C35H56N8O9SPeso molecolare:765 g/molRef: 3D-VAC-00317
Prodotto fuori produzioneProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formula:C153H259N49O52Peso molecolare:3,616.98 g/molRef: 3D-VAC-00682
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzione[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Peso molecolare:344.41 g/molRef: 3D-VAC-00516
Prodotto fuori produzionebeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formula:C68H113N19O19Peso molecolare:1,500.77 g/molRef: 3D-VAC-00506
Prodotto fuori produzioneα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Peso molecolare:1,009.19 g/molRef: 3D-VAC-00246
Prodotto fuori produzioneKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Peso molecolare:1,862.77 g/molRef: 3D-VAC-00770
Prodotto fuori produzioneH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formula:C4H8N2O3Purezza:Min. 95%Peso molecolare:132.12 g/molGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molRef: 3D-VAC-00543
Prodotto fuori produzioneMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SPeso molecolare:2,625 g/molRef: 3D-VAC-00461
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
