
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30476 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fmoc-Glu(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Band 3 Protein (547-553) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H63N11O11Peso molecolare:886.02 g/molBiotin-Exendin 4
<p>Catalogue peptide; min. 95% purity</p>Formula:C194H296N52O62S2Peso molecolare:4,412.96 g/mol[Tyr6,D-Phe7,D-His9]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H57N9O7SPeso molecolare:856.07 g/molFmoc-Leu-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%H-Gly-Gly-NH2·HCl
CAS:<p>Gly-Gly-NH2·HCl is a nanosized antibiotic that has been shown to have antibacterial properties. It is activated by long-chain inorganic acids, such as hydrochloric acid, and organic solvents, such as acetone. This compound has an amide group that makes it acidic. The hydrocarbon chain of this molecule may be either short or long.</p>Formula:C4H9N3O2·HClPurezza:Min. 95%Peso molecolare:167.59 g/molBiotin-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H87N17O13SPeso molecolare:1,286.53 g/molAc-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H139N27O29S2Purezza:Min. 95%Peso molecolare:2,211.44 g/mol((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H49N9O10SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:787.88 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C138H217N35O40SPeso molecolare:3,038.54 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Prodotto controllato<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H84N18O8Purezza:Min. 95%Peso molecolare:1,029.29 g/molH-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3S•(CF3CO2H)xPurezza:Min. 95%Peso molecolare:268.33 g/mol(D-His2,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-His2,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purezza:Min. 95%Peso molecolare:1,269.41 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5 , bovine ,amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C31H42N6O6SPeso molecolare:626.78 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H78N14O19Peso molecolare:1,179.26 g/mol[Met2]-Deltorphin
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H62N10O10S2Peso molecolare:955.17 g/molH-Ile-Glu-OH
CAS:<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O5Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:260.29 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS:<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H166N28O30S3Purezza:Min. 95%Peso molecolare:2,360.78 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C171H254N4O16Peso molecolare:3,870.52 g/molAc-Endothelin-1 (16-21), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H59N9O10Peso molecolare:837.98 g/molH-Phe-Val-OH
CAS:<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>Formula:C14H20N2O3Purezza:Min. 98%Colore e forma:PowderPeso molecolare:264.32 g/molβ-Casomorphin (1-4), amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H35N5O5Peso molecolare:521.62 g/molPRRS-PQGAB-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H76N12O24SPeso molecolare:1,309.33 g/molβ-MSH, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C98H138N26O29SPeso molecolare:2,176.36 g/molParathyroïd Hormone(1-34), bovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C183H288N54O50S2Peso molecolare:4,108.7 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purezza:Min. 95%Colore e forma:Red SolidPeso molecolare:1,687.8 g/mol[Tyr15]-Fibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Formula:C75H102N20O27Peso molecolare:1,715.78 g/molGAD65 (78-97)
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molC-Reactive Protein (CRP) (77-82)
<p>Catalogue peptide; min. 95% purity</p>Formula:C23H40N6O10Peso molecolare:560.61 g/molBiotin-Glucagon (1-29), bovine, human, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C163H239N45O51S2Peso molecolare:3,709.03 g/mol[Phe22] Big Endothelin-1 (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H152N26O26Peso molecolare:2,182.53 g/molH-Ser-Glu-OH
CAS:<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>Formula:C8H14N2O6Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:234.21 g/mol[D-Arg1,D-Phe5,D-Trp7,11]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C75H101N19O12Peso molecolare:1,460.76 g/mol4-Alkoxybenzyl alcohol resin (100-200 mesh)
CAS:<p>4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.</p>Colore e forma:PowderMyristoyl-Lys-Arg-Thr-Leu-Arg-OH
CAS:<p>Myristoyl-Lys-Arg-Thr-Leu-Arg-OH is a synthetic compound that interacts with tyrosine kinase substrate proteins. It inhibits the activation of these proteins and prevents the phosphorylation of tyrosine residues in other substrate proteins. Myristoyl-Lys-Arg-Thr-Leu-Arg-OH has been shown to have potent inhibitory activity against IL2 receptor and adriamycin, which are protein kinases that play important roles in the death pathway.</p>Formula:C42H82N12O8Purezza:Min. 95%Peso molecolare:883.18 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H51N9O7Peso molecolare:685.82 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N2O6·C12H23NPurezza:Min. 95%Peso molecolare:497.67 g/molZ-Gly-Pro-Arg-pNA acetate salt
CAS:Prodotto controllato<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N8O7·C2H4O2Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:642.66 g/mol[Leu144,Arg147]-Myelin Proteolipid Protein(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H110N20O17Peso molecolare:1,467.75 g/molSeglitide acetate
CAS:Prodotto controllato<p>Seglitide is a cyclic peptide that is a model system for the receptor activity of somatostatin. Somatostatin inhibits cells by binding to its receptors, which are found on the surface of endocrine cells and in the hypothalamus. Seglitide has been shown to inhibit cell growth in tissue culture and is a potent inhibitor of epidermal growth factor (EGF) production. Seglitide also activates locomotor activity in mice, suggesting that it may have some clinical relevance. Structural analysis has revealed that seglitide's amino acid sequence is similar to somatostatin's, making them closely related compounds. It also binds to DNA-dependent RNA polymerase, preventing transcription and replication.</p>Formula:C44H56N8O7·C2H4O2Purezza:Min. 95%Peso molecolare:869.02 g/molβ-Endorphin (6-31), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C131H218N34O40Peso molecolare:2,909.40 g/molProinsulin C-peptide (55-89), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C153H259N49O52Peso molecolare:3,616.98 g/molAGRP (25-51)
<p>Catalogue peptide; min. 95% purity</p>Formula:C130H221N37O35SPeso molecolare:2,894.43 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H79N13O12S2Peso molecolare:1,034.31 g/molFmoc-Leu-Gly-OH
CAS:<p>Fmoc-Leu-Gly-OH is a dipeptide that is reversibly soluble in water and organic solvents. It has been found to be stable at millimeter and nanometer scales, which makes it suitable for use as a hydrogel or fiber. Fmoc-Leu-Gly-OH has also been shown to form membranes of variable thickness (from micrometers to nanometers) that are sensitive to pH changes. This means that the membrane can be used for sensing pH levels in a variety of environments. Dipeptides are amphiphiles, meaning they have both hydrophilic and lipophilic properties. This makes them useful for forming self-assembled structures, such as hydrogels and membranes, that are capable of transporting water molecules through the structure.</p>Formula:C23H26N2O5Purezza:Min. 95%Colore e forma:PowderPeso molecolare:410.46 g/molBiotin-LC-Neurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/molActh (1-4)
CAS:<p>Acth (1-4) is the ACTH N-terminal tetrapeptide.</p>Formula:C20H30N4O8SPurezza:98%Colore e forma:SolidPeso molecolare:486.54H-GILGFVFTL-OH
CAS:<p>FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).</p>Formula:C49H75N9O11Peso molecolare:966.18 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purezza:Min. 95%Colore e forma:PowderPeso molecolare:702.71 g/molH-Leu-Leu-Gly-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Leu-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H27N3O4•C2HF3O2Purezza:Min. 95%Peso molecolare:415.4 g/molH-Gly-Leu-Gly-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4•C2HF3O2Purezza:Min. 95%Peso molecolare:359.3 g/molSermorelin acetate
CAS:Prodotto controllato<p>Sermorelin acetate is a synthetic peptide, which is an analogue of the naturally occurring growth hormone-releasing hormone (GHRH). It is derived from recombinant DNA technology, representing the first 29 amino acids (1-29) of endogenous GHRH. Its mode of action involves binding to and activating the GHRH receptor on the anterior pituitary gland, which subsequently stimulates the release of growth hormone (GH) into the bloodstream.</p>Formula:C149H246N44O42S·C2H4O2Purezza:Min. 95%Peso molecolare:3,417.94 g/mol1-Palmitoyl-rac-glycero-3-phosphocholine
CAS:<p>1-Palmitoyl-rac-glycero-3-phosphocholine is a biological lipid that has been shown to be a potent growth factor for cells in culture. It binds to DNA and modulates transcriptional regulation. 1-Palmitoyl-rac-glycero-3-phosphocholine also inhibits the production of lysophosphatidylcholine, which is an inflammatory mediator that promotes the release of histamine from mast cells. This compound may be useful as an antimicrobial agent, as it has been shown to inhibit the growth of bacteria and fungi.</p>Formula:C24H50NO7PPurezza:Min. 95%Peso molecolare:495.63 g/molCerebellin trifluoroacetate
CAS:<p>Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molZ-VRPR-FMK trifluoroacetate
CAS:<p>Z-VRPR-FMK trifluoroacetate is an apoptosis-inducing inhibitor that works by inhibiting a specific kinase in the human body. It has been shown to have anti-cancer properties and may be useful in the treatment of various types of cancer. Z-VRPR-FMK trifluoroacetate is a menthol analog that acts as an inhibitor of apoptosis, which is the process by which cells die naturally. This compound has been tested on Chinese hamster ovary cells and has been found to be effective at inducing apoptosis in these cells. Additionally, Z-VRPR-FMK trifluoroacetate has been shown to inhibit tylosin-induced apoptosis in human colon cancer cells. Overall, this compound shows promise as a potential therapeutic agent for the treatment of cancer and other diseases.</p>Formula:C34H50F4N10O9Purezza:Min. 95%Peso molecolare:818.8 g/molH-ASCLYGQLPK-OH
<p>Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molAc-YVAD-AOM
CAS:<p>Ac-YVAD-AOM is a selective and potent caspase-1 inhibitor showing antitumor activity and potential analgesic activity.</p>Formula:C33H42N4O10Purezza:98%Colore e forma:SolidPeso molecolare:654.715-azido-pentanoyl-RKKRRQRRR-NH2 TFA salt
<p>Peptide 5-azido-pentanoyl-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Colore e forma:PowderPeso molecolare:1,463.78 g/molMycosubtilin
CAS:<p>Mycosubtilin is a potent antifungal lipopeptide, which is a secondary metabolite produced by the bacterium Bacillus subtilis. It is characterized by its ability to disrupt fungal cell membranes, leading to cell lysis and eventual death of the fungus. This mode of action is attributed to its amphiphilic structure, which allows it to integrate into the lipid bilayers of fungal cells, compromising the integrity of the membrane and altering its permeability.Mycosubtilin finds applications in various scientific and agricultural fields due to its efficacy against a broad spectrum of fungal pathogens. It is particularly useful in plant disease management, where it plays a role in biocontrol strategies against phytopathogenic fungi. Additionally, its antifungal properties make it a subject of interest in pharmaceutical research, where it is investigated for potential therapeutic applications in combating fungal infections. Researchers also explore Mycosubtilin as a model compound to understand lipopeptide interactions with membranes, contributing to the broader knowledge of antimicrobial agents.</p>Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea)
CAS:<p>Please enquire for more information about Pheromone Cymit Quimicaesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H259N47O57S2Purezza:Min. 95%Peso molecolare:3,901.26 g/molCoibamide A
CAS:<p>Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/molTPCN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPCN1 antibody, catalog no. 70R-5158</p>Purezza:Min. 95%Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate
CAS:<p>Please enquire for more information about Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2•(C2HF3O2)xPurezza:Min. 95%Peso molecolare:257.29 g/molH-Met-Gln-OH TFA salt
CAS:<p>H-Met-Gln-OH TFA salt is a recombinant human metalloproteinase that has been shown to activate polymorphonuclear and mononuclear cells. H-Met-Gln-OH TFA salt enhances the production of reactive oxygen species and induces the release of proinflammatory cytokines such as tumor necrosis factor alpha, interleukin 1, and interleukin 6. This protein also cleaves sulfoxide bonds in proteins, which may be due to its ability to catalyze the oxidation of sulfhydryl groups in proteins. H-Met-Gln-OH TFA salt has been shown to be effective in enhancing red blood cell production, which may be due to its ability to cleave hemoglobin S bonds in erythrocytes.</p>Formula:C10H19N3O4SPurezza:Min. 95%Peso molecolare:277.34 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formula:C28H32N6O9S·C2HF3O2Purezza:Min. 95%Colore e forma:SolidPeso molecolare:742.68 g/molCarnostatine
<p>Carnostatine (SAN9812), a potent CN1 inhibitor with 11 nM K i, may boost renal carnosine to treat DN.</p>Formula:C10H16N4O4Purezza:98%Colore e forma:SolidPeso molecolare:256.26Lysyllysyllysine
CAS:<p>Lysyllysyllysine is a cationic moiety. It may be used in the construction of gene delivery vectors and DNA nanoparticles.</p>Formula:C18H38N6O4Purezza:98%Colore e forma:SolidPeso molecolare:402.53D-2-Phenylglycine
CAS:Formula:C8H9NO2Purezza:>99.0%(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:151.17Substance P-Gly-Lys-Arg
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C77H124N24O17SPeso molecolare:1690.05Neuropeptide Y-Lys(biotin), Human, rat
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C199H300N57O60S2Peso molecolare:4515.04Oxyntomodulin
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C192H295N59O60SColore e forma:Lyophilized powder, WhitePeso molecolare:4421.9Glucagon (1-29) trifluoroacetate salt, human
CAS:<p>A peptide hormone that plays a role in maintaining glucose homeostasis This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Colore e forma:White, Lyophilized powderProctolin
CAS:<p>Proctolin modulates interneuronal and neuromuscular synaptic transmission in a wide variety of arthropods. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C30H48N8O8Peso molecolare:648.76Somatostatin 28
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C137H207N41O39S3Colore e forma:White to off-white, PowderPeso molecolare:3148.58Ref: 02-J66274
Prodotto fuori produzioneGSK-3 Inhibitor X
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>LH-RH, Salmon
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Histatin 5
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Dynorphin A (1-13), Porcine
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Colore e forma:Lyophilized powderBOC-4-chloro-D-phenylalanine
CAS:Formula:C14H18ClNO4Purezza:98%Colore e forma:SolidPeso molecolare:299.7500Ref: IN-DA0034JQ
Prodotto fuori produzione1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide
CAS:Formula:C8H17N3Purezza:98%Colore e forma:LiquidPeso molecolare:155.2407SLLK, Control Peptide for TSP1 Inhibitor(TFA) (464924-27-4 free base)
<p>SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.</p>Formula:C23H42F3N5O8Purezza:98%Colore e forma:SolidPeso molecolare:573.6Elamipretide acetate
<p>Elamipretide acetate (MTP 131), a small tetrapeptide, targets mitochondria to reduce toxic species and stabilize cardiolipin.</p>Formula:C34H53N9O7Purezza:99.76%Colore e forma:SoildPeso molecolare:699.84PalMitoyl Tripeptide-1 hydrochloride
CAS:<p>PalMitoyl Tripeptide-1 hydrochloride (PalMitoyl Tripeptide-1 hydrochloride (147732-56-7 Free base)) has effects on the synthesis of collagen, fibronectin and hyaluronic acid in human skin fibroblasts, and can be used in the preparation of anti-aging cosmetics.</p>Formula:C30H55ClN6O5Purezza:98%Colore e forma:SolidPeso molecolare:615.25Tripeptide-41
CAS:<p>Tripeptide-41 (CG-Lipoxyn) is a bioactive peptide known for its ability to reduce fat accumulation.</p>Formula:C29H30N4O5Purezza:98%Colore e forma:SolidPeso molecolare:514.57Pam2CSK4 TFA
<p>Pam2CSK4 TFA (PUL-042 TFA) is a potent dual agonist of TLR2 and TLR6, a peptide that mimics bacterial lipoproteins.Pam2CSK4 TFA promotes platelet aggregation, and can be used to study the effects of lipoproteins on the periodontium.</p>Formula:C67H127F3N10O14SPurezza:99.90%Colore e forma:SoildPeso molecolare:1385.84OVA Peptide 323-339
<p>OVA Peptide (323-339) is an Ovalbumin epitope crucial for hypersensitivity in BALB/c mice.</p>Formula:C74H120N26O25Purezza:98%Colore e forma:SolidPeso molecolare:1773.91CBD3063
CAS:<p>CBD3063 is a CRMP2-based peptidomimetic small molecule that can regulate Cav 2.2 and can be used to study neurological diseases.</p>Formula:C16H25N5O2Purezza:99.39%Colore e forma:SoildPeso molecolare:319.4(D)-PPA 1
CAS:<p>PD-1/PD-L1 binder, Kd 0.51 μM; blocks interaction in flow cytometry at 1 mg/mL; inhibits tumors, extends mouse survival.</p>Formula:C70H98N20O21Purezza:98%Colore e forma:SolidPeso molecolare:1555.67Darobactin
CAS:<p>Darobactin is an antibiotic effective against critical Gram-negative pathogens, demonstrating activity both in vitro and in animal infection models [1].</p>Formula:C47H55N11O12Purezza:98%Colore e forma:SolidPeso molecolare:966.015-Benzyl D-Glutamate
CAS:Formula:C12H15NO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:237.26CJC-1295
CAS:Formula:C152H252N44O42Purezza:95%~99%Colore e forma:White to Off-white PowderPeso molecolare:3367.897D-Proline tert-Butyl Ester Hydrochloride
CAS:Formula:C9H17NO2·HClPurezza:>98.0%(GC)(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:207.703-Amino-N-benzyloxycarbonyl-L-alanine
CAS:Formula:C11H14N2O4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:238.24MTP 131 acetate
CAS:<p>MTP 131 (acetate) is a small mitochondrially-targeted tetrapeptide.</p>Formula:C34H53N9O7Purezza:99.9%Colore e forma:SolidPeso molecolare:699.84Elamipretide
CAS:<p>Elamipretide (SS-31, MTP-131, Bendavia) is a mitochondria-focused peptide that curbs toxic ROS and stabilizes cardiolipin.</p>Formula:C32H49N9O5Purezza:98.53% - 99.85%Colore e forma:SolidPeso molecolare:639.79H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-SHGQDYLVGNK^-OH
<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>






