Peptidi
Sottocategorie di "Peptidi"
Trovati 29793 prodotti di "Peptidi"
PKA Substrate
Substrate peptide for adenosine 3',5'-monophosphate (cyclic AMP)-dependent protein kinase (PKA) and related kinases, for use in kinase assays. The peptide sequence is based on the cAMP-dependent protein kinase inhibitor alpha (amino acid 15-23).Protein kinase A (PKA) also known as cAMP-dependent protein kinase is a family of serine/threonine protein kinase enzymes whose activity is regulated by cyclic AMP (cAMP). PKA is involved in a plethora of roles within the cell including: regulation of glycogen, sugar and lipid metabolism and roles within adipocytes and hepatocytes, nucleus accumbens neurons, skeletal muscle, cardiac muscle and in memory formation.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,117.6 g/molHLA-DRB1*1501 peptide
The HLA-DRB1*1501 peptide, is encoded by the disease-associated MHC allele histocompatibility leukocyte antigen (HLA)-DRB1*1501 which is present on the MHC region of chromosome 6. The increased frequency of the HLA-DRB*11501 haplotype found in Multiple Sclerosis (MS) patients, may contribute to the MS phenotype through disrupting T cell repertoire selection and through the presentation of self-peptides which can be targeted by the body's autoimmune response. Moreover studies investigating the accumulation of amyloid β-peptide (Aβ) as a factor producing Alzheimer's disease (AD) pathogenicity, found that HLA-DR alleles such as DRB1*1501 demonstrate immunogenic properties. It is evident that the DRB1*1501 halotype is associated with strong Aβ-T cell responses resulting in the large production of IFN- γ and IL-17. Therefore the HLA-DRB1*1501 peptide would be beneficial in studies exploring the phenotypes of autoimmune-diseases like MS and AD.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,568.7 g/molHBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-YTFELSR^-OH
Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KK^V^VFKVKF^K^-NH2
Peptide H-KK^V^VFKVKF^K^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNILNNK^-OH
Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KYSEEGDGPAQHAEQC-NH2
Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.C-terminal Sortagging-[Cys(AF680)] acid
This C-terminal Sortagging peptide acts as an (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Cys(AF680)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye. This method of protein labelling is known as sortagging.C-Terminal Sortagging-[Cys(AF680)] contains the AF680 fluorescent dye- AF680 is a bright green dye with excitation at 633 nm, well suited for flow cytometry and imagery. AF680 is particularly photostable, allowing better detection of low abundance conjugates. C-Terminal Sortagging-[Cys(AF680)] acid is provided here. However, the amide version is also available.Purezza:Min. 95%Peso molecolare:1,241.3 g/molHXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,624.8 g/molMOG (35-55) acid Mouse, Rat
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail. MOG may function as a cell surface receptor or cell adhesion molecule. Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for autoantibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.The MOG (35-55) fragment is the most potent auto-antigenic region of MOG, and the most effective at inducing experimental autoimmune/allergic encephalomyelitis (EAE), an animal model that resembles MS. This peptide has a free carboxylic acid at the C-terminus, an amide version is also available in our catalogue.Formula:C118H177N35O29SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:2,581.95 g/molH-NQNTFLR^-OH
Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-26
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,788 g/molH-EQAPNLVYMVTGNPASDEIK^-OH
Peptide H-EQAPNLVYMVTGNPASDEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GENFTETDVK^-OH
Peptide H-GENFTETDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDVFVIR^-OH
Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLVTGLWGK^-OH
Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-YLGRSYKV-NH2
Peptide Ac-YLGRSYKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecolare:1,026.2 g/molH-FQTAAQR^-OH
Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SHLVEALYLVCGERG-NH2
Peptide Ac-SHLVEALYLVCGERG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.6Fam-SHLVEALYL^VCGER^G-NH2
Peptide 6Fam-SHLVEALYL^VCGER^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KIFMTK-NH2
Peptide Ac-KIFMTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FL^GYLILGV-OH
Peptide H-FL^GYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-EQKLISEEDLC-OH
Peptide Ac-EQKLISEEDLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYNVTYTVK^-OH
Peptide H-VYNVTYTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-MSH (monkey)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C98H138N28O29SPeso molecolare:2,204.41 g/molLCBiot-TSYQVYSK-OH
Peptide LCBiot-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTVVILEAK^-OH
Peptide H-LTVVILEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIGELYLPK^-OH
Peptide H-EIGELYLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLNATGEEIIQQSSK^-OH
Peptide H-TLNATGEEIIQQSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[5-FAM]-GLP-1
Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with multiple roles in relation to metabolism. The primary role of GLP-1 is increasing insulin secretion in the presence of high plasma glucose levels, in addition, GLP-1 also suppresses glucagon secretion from the pancreas. GLP-1 slows down gastric emptying and regulates appetite, both valuable in reducing food intake and body weight. These roles of GLP-1 make it a useful target in the management of type 2 diabetes mellitus (T2DM).GLP-1 exerts its effects by binding to and activating the class B G protein-coupled receptor (GPCR): GLP-1 receptor (GLP-1R). Receptor activation in turn activates signalling pathways which culminates in insulin secretion via CAMP and Ca2+ signalling.Recently evidence has increased for GLP-1 playing a cardio-protective role as well as regulating immune responses and even in kidney function. GLP-1 may also exert neuroprotective and neurotropic effects as it can decrease endogenous levels of amyloid-β (Aβ) and prevent Aβ-induced cell death.This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:4,467.1 g/molH-CREKA-OH
Peptide H-CREKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C23H43N9O8SPeso molecolare:605.72 g/molEBV LMP2 356-364 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GDVAFVK^-OH
Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGAMSP^MSWNSDASTSEAS-OH
Peptide H-SGAMSP^MSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANDESNEHSDVIDSQELSK^-OH
Peptide H-ANDESNEHSDVIDSQELSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C96H174N36O29Peso molecolare:2,296.7 g/molH-SL^EDLQL^THNK^-OH
Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,758.2 g/molLCMV gp 276-286 (H-2 Db)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C46H70N12O17SPeso molecolare:1,095.18 g/molH-NPQLCYQDTILWK^-OH
Peptide H-NPQLCYQDTILWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Anxiety peptide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C81H138N24O29Peso molecolare:1,912.13 g/molBiot-APRTPGGRR-OH
Peptide Biot-APRTPGGRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-WLA-AMC
Peptide Ac-WLA-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:587.7 g/molInfluenza virus HA epitope
Peptide H-CYPYDVPDYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFVLNLGK^-OH
Peptide H-SFVLNLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gly-Thr-Trp-Tyr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C26H31N5O7Peso molecolare:525.55 g/molH-DTEVLLVGLEPGTR^-OH
Peptide H-DTEVLLVGLEPGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSSTSPGDYVL^SVSENSR-OH
Peptide H-DSSTSPGDYVL^SVSENSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.beta-Casomorphin (1-2)
CAS:Beta-casomorphin (1-2) is a peptide that has been identified as a possible endogenous ligand for opioid receptors. It is a product of the breakdown of casomorphin, a milk protein found in dairy products such as cheese and yogurt. Beta-casomorphin (1-2) has been shown to bind to human immunodeficiency virus type 1 receptors and may play an important role in the pathogenesis of human immunodeficiency virus type 1 infection. This peptide also inhibits bacterial growth by binding to bacterial ribosomes, preventing the formation of new proteins, which leads to cell death. Beta-casomorphin (1-2) has been shown to have an inhibitory effect on blood pressure and its antihypertensive activity may be due to its ability to stimulate the release of nitric oxide from endothelial cells.Formula:C14H18N2O4Purezza:Min. 97 Area-%Colore e forma:PowderPeso molecolare:278.3 g/molH-VADPDHDHTGFLTEYVATR^-OH
Peptide H-VADPDHDHTGFLTEYVATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-MNFLLSWVHWSLALLLYLHHAKWSQA-OH
Peptide LCBiot-MNFLLSWVHWSLALLLYLHHAKWSQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FL^PEFGISSA-OH
Peptide H-FL^PEFGISSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WRWYRGGRYWRW-NH2
Peptide H-WRWYRGGRYWRW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
AF488 6xHis Tag
[AF488] 6xHis Tag, composed of a hexa-histidine tag and the fluorescent dye, Alexa Fluor 488 (AF488).Purezza:Min. 95%Peso molecolare:1,356.4 g/molH-VGGTGMFTVR^-OH
Peptide H-VGGTGMFTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGGVGKSAL^-OH
Peptide H-GAGGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSSE-OH
Peptide H-FSSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Purezza:Min. 95 Area-%Peso molecolare:468.46 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPQVYTLPPSR^-OH
Peptide H-EPQVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDLSNVQSK^-OH
Peptide H-LDLSNVQSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKFVAAWTLKAAA-OH
Pan HLA DR-binding epitope (PADRE) is a universal peptide that activates CD4+ T cells which can be used as an agonist adjuvant.
H-RCGPDCFDNYGRYKYCF-NH2
Peptide H-RCGPDCFDNYGRYKYCF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ser-Asp-OH
CAS:H-Ser-Asp-OH is a peptide that is the product of the prokaryotic gene, mycobacterium avium. It has been shown to inhibit the translation of mRNA into protein in mycobacteria. H-Ser-Asp-OH also has an anti-inflammatory effect on human cells by inhibiting the synthesis of prostaglandins. This peptide also has antiviral properties and can be used as a treatment for chronic kidney disease (CKD) and hepatitis C. The drug is not effective against HIV infection or hepatitis B virus, however, because it does not inhibit reverse transcriptase or bind to viral DNA.Formula:C7H12N2O6Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:220.18 g/molGluten Exorphin B5 H-Tyr-Gly-Gly-Trp-Leu-OH
CAS:Gluten Exorphin B5 H-Tyr-Gly-Gly-Trp-Leu-OH is a synthetic opioid peptide that has been shown in animal models to reduce food intake and body weight. This peptide is an analog of the endogenous opioid peptides Met-enkephalin and Leu-enkephalin, which have been implicated in the regulation of food intake and energy expenditure. Gluten exorphin B5 H-Tyr-Gly-Gly-Trp-Leu-OH binds to the μ opioid receptor, which is involved in drug safety. It also binds to the prolactin receptor, which plays a role in drug absorption and distribution.Formula:C30H38N6O7Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:594.66 g/molH-THTHIVIPYR^-OH
Peptide H-THTHIVIPYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,629.9 g/molH-LGTLLPLQK^-OH
Peptide H-LGTLLPLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SMAC/DIABLO-[Cys(AF647)]
SMAC/DIABLO-[Cys(AF647)] is a pro-apoptotic peptide that is derived from the mitochondrial protein known either as Second Mitochondria-Derived Activator of Caspases (Smac) or Direct IAP Binding Protein with low isoelectric point, pI (DIABLO). During apoptosis the mitochondria has increased permeability to Smac/DIABLO, which causes the protein to diffuse into the cytosol. Here, Smac/DIABLO adheres to Inhibitors of apoptosis proteins (IAPs) and prevents them from binding to caspases, which in turn accentuates apoptosis.This peptide has a C-terminal cysteine linker labelled with AF647, which is a bright, far-red-fluorescent dye with excitation between 594 nm and 633 nm.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,427.7 g/molMyr-GRTGRRNAI-NH2
Peptide Myr-GRTGRRNAI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-RRYQNSTEL-OH
Peptide Fluor-RRYQNSTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 86 (QYDPVAALFFFDIDL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,774 g/molSBP1
Fragment of the angiotensin-converting enzyme 2 (ACE2) peptidase domain (PD) alpha1 helix, a domain important for the interaction of ACE2 with the severe acute respiratory syndrome (SARS coronavirus receptor binding domain (SARS-CoV-2-RBD). SBP1 associates with the SARS-CoV-2-RBD with nanomolar affinity and can potentially block the key mechanism by which SARS CoV-2 initiates entry into human cells.Purezza:Min. 95%Colore e forma:PowderH-AGFAGDDAPR^^-OH
Peptide H-AGFAGDDAPR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Des-Gly10,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:Please enquire for more information about (Des-Gly10,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C59H84N16O12•(C2HF3O2)xPurezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:1,209.4 g/molFluor-YGGFL-OH
Peptide Fluor-YGGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Cys(Dpm)-OH
CAS:Fmoc-Cys(Dpm)-OH is a chemical that belongs to the group of reaction components. It is a high quality reagent for research and development and can be used as a building block in the synthesis of other fine chemicals. Fmoc-Cys(Dpm)-OH is also an intermediate for the synthesis of complex compounds such as peptides, proteins, and antibiotics. This compound has a broad range of applications in biomedicine, organic chemistry, and pharmaceuticals.
Formula:C31H27NO4SPurezza:Min. 95%Colore e forma:White SolidPeso molecolare:509.62 g/molFluor-SSIEFARL-OH
Peptide Fluor-SSIEFARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFQLFGSPPGQR^-OH
Peptide H-SFQLFGSPPGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALDFFAR^-OH
Peptide H-EALDFFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Blocking peptide for Neurogranin pAb (Prod. No. BML-NA1300)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,828.1 g/molH-L^GP^L^VEQGR^-OH
Peptide H-L^GP^L^VEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Asp(OBzl)-Pro-Arg-AMC·HCl
CAS:Boc-Asp(OBzl)-Pro-Arg-AMC·HCl is a high quality, reagent, complex compound and useful intermediate. It is a fine chemical with the CAS Number 201849-39-0 that is used in research and development. Boc-Asp(OBzl)-Pro-Arg-AMC·HCl is also a versatile building block that can be used in reactions for the synthesis of other compounds.
Formula:C37H47N7O9·HClPurezza:Min. 98 Area-%Colore e forma:White PowderPeso molecolare:770.27 g/molH-EVPLNTIIFMGR^-OH
Peptide H-EVPLNTIIFMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GGG-[K(5-TAMRA)] C-terminal Sortagging
This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Lys(5-TAMRA)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye. This method of protein labelling is known as sortagging.5-Carboxytetramethylrhodamine (5-TAMRA) is a widely used fluorescent dye which excites at 546 nm and emits at 579 nm.Purezza:Min. 95%Colore e forma:PowderPeso molecolare:728.3 g/molH-HVPGGGSVQIVYKPVDLSK^-OH
Peptide H-HVPGGGSVQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Val-Gly-OH
CAS:Fmoc-Val-Gly-OH is a Research Chemical that is commonly used in the field of efficient synthesis. It is an amino acyl compound that can be utilized for the synthesis of various molecules. Fmoc-Val-Gly-OH is known for its high efficiency and reliability in producing desired results. It can be easily analyzed using spectrometry techniques, allowing researchers to accurately determine its composition and purity. This versatile compound can react with azides, alcohols, and other compounds to create new chemical entities. With its efficient properties, Fmoc-Val-Gly-OH is an essential tool for scientists and researchers in their quest for innovative discoveries.
Formula:C22H24N2O5Purezza:Min. 95%Peso molecolare:396.44 g/molAF488 Insulin
Insulin is a peptide hormone produced by β cells of the pancreatic islets that regulates carbohydrates metabolism. It is a heterodimer of an A-chain and a B-chain, which are linked together by disulfide bonds. Insulin stimulates the absorption of glucose from the blood into fat, muscle and liver cells where it is converted into either glycogen or fat.Insulin is secreted in the blood as a response to high level of blood glucose resulting in enhanced glucose uptake and metabolism in the cells so to reduce blood glucose levels. Circulating insulin also affects the synthesis of proteins in many tissues. Low blood insulin levels result in catabolism, particularly of reserve body fat. A decrease or absence of insulin activity results in diabetes mellitus, a condition of high blood sugar level (hyperglycaemia).N-terminal chain B labelled with AF488. AF488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. AF488 dye is pH-insensitive over a wide molar range.Purezza:Min. 95%Peso molecolare:6,319.6 g/molGPS1573
GPS1573 is a potent and dose-dependent peptide antagonist of adrenocorticotrophic (ACTH) -stimulated melanocortin type 2 receptor (MC2R). Along with GPS1574, GPS1773 is an ACTH analogue and as such antagonises MC2R in the nanomolar range.The clinical relevance of GPS1573 is related to Cushing's disease and syndrome, which are both associated with a hypercortisolemic state. Selective antagonism of MC2R using GPS1573 may be a novel treatment modality for Cushing's disease and syndrome.Purezza:Min. 95%Colore e forma:PowderAC 187
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C127H205N37O40Peso molecolare:2,890.25 g/molAc-Lys-AMC acetate salt
CAS:Ac-Lys-AMC acetate salt is a fine chemical that is used as a building block in biological research. It is a versatile building block that can be used in the synthesis of complex compounds, and as a reaction component for the production of useful intermediates. Ac-Lys-AMC acetate salt is also used as a reagent in the detection of nucleic acids.Formula:C18H23N3O4•C2H4O2Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:405.44 g/molAc-CKSGTGIAAMSVMRPEQ-NH2
Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFEPTLEALFGK^-OH
Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,618.9 g/molH-VGNEIQYVALR^-OH
Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-FSPDDSAGASALLR-OH
Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuropeptide Y, human, rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C189H285N55O57S1Peso molecolare:4,271.74 g/mol
![C-terminal Sortagging-[Cys(AF680)] acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101684.webp&w=3840&q=75)
![[5-FAM]-GLP-1](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100880.webp&w=3840&q=75)
![[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50524.webp&w=3840&q=75)
![SMAC/DIABLO-[Cys(AF647)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110326.webp&w=3840&q=75)
![GGG-[K(5-TAMRA)] C-terminal Sortagging](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100651.webp&w=3840&q=75)
