Peptidi
Sottocategorie di "Peptidi"
Trovati 29773 prodotti di "Peptidi"
Kinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Peso molecolare:1,862.77 g/molRef: 3D-VAC-00770
Prodotto fuori produzioneAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Peso molecolare:1,715.91 g/molRef: 3D-VAC-00251
Prodotto fuori produzionePACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SPeso molecolare:2,638.15 g/molRef: 3D-VAC-00014
Prodotto fuori produzionep3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formula:C59H97N17O19Peso molecolare:1,348.53 g/molRef: 3D-VAC-00383
Prodotto fuori produzioneFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Peso molecolare:359.43 g/molRef: 3D-VAC-00050
Prodotto fuori produzioneBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SPeso molecolare:3,103.54 g/molRef: 3D-VAC-00617
Prodotto fuori produzioneMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.
Formula:C28H36N6O10Purezza:Min. 95%Peso molecolare:616.6 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP46914
Prodotto fuori produzioneAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H63N15O13Purezza:Min. 95%Peso molecolare:1,082.13 g/molRef: 3D-FA110993
Prodotto fuori produzioneMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purezza:Min. 95%Colore e forma:PowderPeso molecolare:2,695.98 g/molRef: 3D-FM109206
Prodotto fuori produzioneH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formula:C4H8N2O3Purezza:Min. 95%Peso molecolare:132.12 g/molZ-Ile-Trp-OH
CAS:Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C25H29N3O5Purezza:Min. 95%Peso molecolare:451.51 g/molRef: 3D-FI111493
Prodotto fuori produzioneH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O6C2F3HO2Purezza:Min. 95%Peso molecolare:348.23 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneDesmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Peso molecolare:937.08 g/molRef: 3D-VAC-00048
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzioneSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formula:C40H51N5O18P2Peso molecolare:951.86 g/molRef: 3D-VAC-00020
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzionebeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molRef: 3D-VAC-00429
Prodotto fuori produzioneRef: 3D-VAC-00563
Prodotto fuori produzione[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Peso molecolare:2,182.53 g/molRef: 3D-VAC-00505
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Peso molecolare:3,709.03 g/molRef: 3D-VAC-00100
Prodotto fuori produzione[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formula:C35H56N8O9SPeso molecolare:765 g/molRef: 3D-VAC-00317
Prodotto fuori produzione[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Peso molecolare:4,838.43 g/molRef: 3D-VAC-00857
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Peso molecolare:3,261.54 g/molRef: 3D-VAC-00315
Prodotto fuori produzione[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Peso molecolare:2,311.60 g/molRef: 3D-VAC-00893
Prodotto fuori produzionebeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Peso molecolare:424.50 g/molRef: 3D-VAC-00901
Prodotto fuori produzioneFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purezza:Min. 95%Peso molecolare:604.65 g/molRef: 3D-FF111346
Prodotto fuori produzioneParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Peso molecolare:4,472.26 g/molRef: 3D-VAC-00752
Prodotto fuori produzione[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formula:C28H38N6O6SPeso molecolare:586.72 g/molRef: 3D-VAC-00854
Prodotto fuori produzioneHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molRef: 3D-VAC-00698
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Peso molecolare:1,171.33 g/molRef: 3D-VAC-00629
Prodotto fuori produzione[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00911
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Peso molecolare:1,564.86 g/molRef: 3D-VAC-00329
Prodotto fuori produzioneAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formula:C40H52N10O13Peso molecolare:880.92 g/molRef: 3D-VAC-00215
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:392.49 g/molRef: 3D-FR108333
Prodotto fuori produzioneRef: 3D-VAC-00032
Prodotto fuori produzionebeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SPeso molecolare:3,260.75 g/molRef: 3D-VAC-00721
Prodotto fuori produzione[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Peso molecolare:1,541.73 g/molRef: 3D-VAC-00456
Prodotto fuori produzionebeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SPeso molecolare:2,392.86 g/molRef: 3D-VAC-00589
Prodotto fuori produzioneCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SPeso molecolare:6,220.84 g/molRef: 3D-VAC-00238
Prodotto fuori produzioneDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Peso molecolare:1,664.90 g/molRef: 3D-VAC-00578
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Peso molecolare:1,009.19 g/molRef: 3D-VAC-00246
Prodotto fuori produzionePGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SPeso molecolare:1,464.75 g/molRef: 3D-VAC-00045
Prodotto fuori produzioneBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Peso molecolare:3,552.17 g/molRef: 3D-VAC-00097
Prodotto fuori produzioneRef: 3D-VAC-00566
Prodotto fuori produzioneRef: 3D-VAC-00358
Prodotto fuori produzioneRef: 3D-VAC-00673
Prodotto fuori produzioneCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Peso molecolare:930.04 g/molRef: 3D-VAC-00190
Prodotto fuori produzione[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Peso molecolare:3,969.50 g/molRef: 3D-VAC-00921
Prodotto fuori produzioneCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-BC183139
Prodotto fuori produzioneMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H246N41O40P3Peso molecolare:3,320.78 g/molRef: 3D-VAC-00525
Prodotto fuori produzione[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formula:C78H121N21O20Peso molecolare:1,673 g/molRef: 3D-VAC-00160
Prodotto fuori produzioneZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C19H28N2O5Purezza:Min. 95%Peso molecolare:364.44 g/molRef: 3D-FI111494
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzioneFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H14N2O3Purezza:Min. 90%Colore e forma:PowderPeso molecolare:174.2 g/molRef: 3D-FA107958
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRef: 3D-FS108741
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
