Peptidi
Sottocategorie di "Peptidi"
Trovati 29799 prodotti di "Peptidi"
[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formula:C44H62N10O10S2Peso molecolare:955.17 g/molRef: 3D-VAC-00898
Prodotto fuori produzioneN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:392.49 g/molRef: 3D-FR108333
Prodotto fuori produzione2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Peso molecolare:937.08 g/molRef: 3D-VAC-00048
Prodotto fuori produzionebeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SPeso molecolare:2,392.86 g/molRef: 3D-VAC-00589
Prodotto fuori produzioneSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzioneADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Peso molecolare:1,319.58 g/molRef: 3D-VAC-00433
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzioneProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formula:C103H156N32O25Peso molecolare:2,242.59 g/molRef: 3D-VAC-00767
Prodotto fuori produzioneGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurezza:Min. 95%Peso molecolare:1,550.78 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/molRef: 3D-VAC-00065
Prodotto fuori produzioneKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formula:C72H108N19O27Peso molecolare:1,702.77 g/molRef: 3D-VAC-00772
Prodotto fuori produzioneSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molRef: 3D-VAC-00604
Prodotto fuori produzione[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formula:C63H103N25O19Peso molecolare:1,514.68 g/molRef: 3D-VAC-00679
Prodotto fuori produzioneChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SPeso molecolare:1,269.31 g/molRef: 3D-VAC-00756
Prodotto fuori produzioneAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formula:C86H119N23O23Peso molecolare:1,843.05 g/molRef: 3D-VAC-00471
Prodotto fuori produzioneFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purezza:Min. 95%Peso molecolare:878.85 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molRef: 3D-VAC-00234
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzioneFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Peso molecolare:850.00 g/molRef: 3D-VAC-00408
Prodotto fuori produzionebeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formula:C170H253N47O52Peso molecolare:3,787.20 g/molRef: 3D-VAC-00310
Prodotto fuori produzioneTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Peso molecolare:727.79 g/molRef: 3D-VAC-00424
Prodotto fuori produzioneBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C172H276N52O54S3Peso molecolare:4,032.63 g/molRef: 3D-VAC-00115
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzione[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formula:C59H86N16O15Peso molecolare:1,259.44 g/molRef: 3D-VAC-00346
Prodotto fuori produzioneBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SPeso molecolare:3,849.30 g/molRef: 3D-VAC-00188
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzioneDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formula:C27H48N8O7S3Purezza:Min 95%Peso molecolare:692.92 g/molRef: 3D-CRB7108314
Prodotto fuori produzioneAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H63N15O13Purezza:Min. 95%Peso molecolare:1,082.13 g/molRef: 3D-FA110993
Prodotto fuori produzioneC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formula:C50H86N22O17Peso molecolare:1,267.38 g/molRef: 3D-VAC-00689
Prodotto fuori produzioneDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Peso molecolare:1,664.90 g/molRef: 3D-VAC-00578
Prodotto fuori produzioneRef: 3D-VAC-00718
Prodotto fuori produzioneFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C45H47FN6O14Purezza:Min. 95%Peso molecolare:914.89 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formula:C72H122N21O29SPeso molecolare:1,777.92 g/molRef: 3D-VAC-00122
Prodotto fuori produzioneBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formula:C217H322N58O60SPeso molecolare:4,767.47 g/molRef: 3D-VAC-00119
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneRef: 3D-VAC-00560
Prodotto fuori produzioneCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formula:C46H68N10O14SPeso molecolare:1,017.17 g/molRef: 3D-VAC-00783
Prodotto fuori produzione[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Peso molecolare:1,260.47 g/molRef: 3D-VAC-00511
Prodotto fuori produzionePrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Peso molecolare:902.02 g/molRef: 3D-VAC-00263
Prodotto fuori produzioneBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formula:C82H122N22O25SPeso molecolare:1,848.08 g/molRef: 3D-VAC-00123
Prodotto fuori produzioneRef: 3D-VAC-00224
Prodotto fuori produzioneH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H14N2O3Purezza:Min. 90%Colore e forma:PowderPeso molecolare:174.2 g/molRef: 3D-FA107958
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzione[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Peso molecolare:3,969.50 g/molRef: 3D-VAC-00921
Prodotto fuori produzioneRef: 3D-VAC-00566
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formula:C93H136N22O27Peso molecolare:1,994.25 g/molRef: 3D-VAC-00647
Prodotto fuori produzione[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formula:C67H110N20O17Peso molecolare:1,467.75 g/molRef: 3D-VAC-00495
Prodotto fuori produzionegp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formula:C135H221N45O33Peso molecolare:3,002.55 g/molRef: 3D-VAC-00900
Prodotto fuori produzioneAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formula:C165H261N51O55S2Purezza:Min. 95%Peso molecolare:3,903.28 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formula:C46H75N9O11S2Peso molecolare:994.28 g/molRef: 3D-VAC-00233
Prodotto fuori produzioneMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purezza:Min. 95%Colore e forma:PowderPeso molecolare:2,695.98 g/molRef: 3D-FM109206
Prodotto fuori produzione[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Peso molecolare:1,541.73 g/molRef: 3D-VAC-00456
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzioneBoc-D-Glu-OEt·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurezza:Min. 95%Peso molecolare:456.62 g/molRef: 3D-FB111281
Prodotto fuori produzione[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SPeso molecolare:3,710.26 g/molRef: 3D-VAC-00470
Prodotto fuori produzioneGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formula:C194H318N62O62SPeso molecolare:4,543.14 g/molRef: 3D-VAC-00847
Prodotto fuori produzioneFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purezza:Min. 95%Peso molecolare:604.65 g/molRef: 3D-FF111346
Prodotto fuori produzioneRef: 3D-VAC-00724
Prodotto fuori produzioneHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Peso molecolare:4,017.55 g/molRef: 3D-VAC-00260
Prodotto fuori produzioneAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molRef: 3D-VAC-00452
Prodotto fuori produzioneBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molRef: 3D-VAC-00084
Prodotto fuori produzioneRef: 3D-VAC-00483
Prodotto fuori produzioneAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formula:C88H139N25O26Peso molecolare:1,963.24 g/molRef: 3D-VAC-00049
Prodotto fuori produzioneCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Peso molecolare:1,770.34 g/molRef: 3D-VAC-00558
Prodotto fuori produzioneAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molRef: 3D-VAC-00168
Prodotto fuori produzioneBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formula:C126H190N34O35Peso molecolare:2,773.19 g/molRef: 3D-VAC-00091
Prodotto fuori produzioneBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purezza:Min. 95%Colore e forma:SolidPeso molecolare:355.39 g/molRef: 3D-FB111250
Prodotto fuori produzioneAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formula:C164H278N58O45S4Peso molecolare:3,910.64 g/molRef: 3D-VAC-00235
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzioneBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SPeso molecolare:3,103.54 g/molRef: 3D-VAC-00617
Prodotto fuori produzioneRef: 3D-VAC-00183
Prodotto fuori produzioneSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Peso molecolare:2,596 g/molRef: 3D-VAC-00294
Prodotto fuori produzioneBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:402.65 g/molRef: 3D-EB110885
Prodotto fuori produzioneAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formula:C79H116N22O17Peso molecolare:1,645.9 g/molRef: 3D-VAC-00344
Prodotto fuori produzioneBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molRef: 3D-VAC-00878
Prodotto fuori produzioneAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formula:C79H125N23O28SPeso molecolare:1,877.08 g/molRef: 3D-VAC-00602
Prodotto fuori produzione[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formula:C28H36N6O6Peso molecolare:552.64 g/molRef: 3D-VAC-00828
Prodotto fuori produzioneRef: 3D-VAC-00430
Prodotto fuori produzione[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formula:C143H226N38O39SPeso molecolare:3,133.71 g/molRef: 3D-VAC-00202
Prodotto fuori produzionebeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molRef: 3D-VAC-00429
Prodotto fuori produzioneC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Peso molecolare:560.61 g/molRef: 3D-VAC-00793
Prodotto fuori produzioneAc-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formula:C41H59N9O10Peso molecolare:837.98 g/molRef: 3D-VAC-00033
Prodotto fuori produzione[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Peso molecolare:2,311.60 g/molRef: 3D-VAC-00893
Prodotto fuori produzionebeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Peso molecolare:424.50 g/molRef: 3D-VAC-00901
Prodotto fuori produzioneParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Peso molecolare:4,472.26 g/molRef: 3D-VAC-00752
Prodotto fuori produzioneHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molRef: 3D-VAC-00698
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneRef: 3D-VAC-00385
Prodotto fuori produzionebeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formula:C42H66N10O15Peso molecolare:951.05 g/molRef: 3D-VAC-00373
Prodotto fuori produzioneDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Peso molecolare:1,524.72 g/molRef: 3D-VAC-00577
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
