Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
pp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C66H109N23O23Peso molecolare:1,592.74 g/molRef: 3D-VAC-00687
Prodotto fuori produzionebeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzioneα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Peso molecolare:882.04 g/molRef: 3D-VAC-00818
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzioneRef: 3D-VAC-00750
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneRef: 3D-VAC-00385
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzioneMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H243N41O31Peso molecolare:3,080.83 g/molRef: 3D-VAC-00526
Prodotto fuori produzioneFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purezza:Min. 95%Peso molecolare:604.65 g/molRef: 3D-FF111346
Prodotto fuori produzioneDesmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/molH-His-Arg-OH
CAS:H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formula:C12H21N7O3Purezza:Min. 95%Peso molecolare:311.34 g/molZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C19H28N2O5Purezza:Min. 95%Peso molecolare:364.44 g/molRef: 3D-FI111494
Prodotto fuori produzioneCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-BC183139
Prodotto fuori produzione
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
