Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30433 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-KDLLEQKRAAVDTYC-NH2
<p>Peptide H-KDLLEQKRAAVDTYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGQQVPYATK^-OH
<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LPETGG-NH2
<p>Peptide LCBiot-LPETGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-O
<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 70 (PKNMIIKPGKISHIM)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,707.2 g/molMelanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C44H67N9O14Peso molecolare:946.05 g/molH-GLDSEESYPYEAK^^-OH
<p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tum-P35B Peptide (NGPPHSNNFGY)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LVYHLGLPFSFLTFPYVEEAIK^-OH
<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5-FAM-Fz7-21
<p>Fz7-21 is a potent and selective peptide antagonist of Frizzled 7 (FZD 7) receptor which selectively binds to FZD7 cysteine rich domain (CRD) subclass at the cysteine rich region proximal to the lipid-binding groove. Binding alters the conformation of the CRD and the architecture of its lipid-binding groove and impairs Wnt/β-catenin signalling. Peptide Fz7-21 also shows cross-species binding to both the human and mouse FZD7 CRD.The FZD7 receptor is enriched in intestinal stem cells which express the LGR5 receptor and plays a critical role in the cells self-renewal. FZD7 is essential for maintaining human embryonic stem cells in their undifferentiated state and is therefore an attractive pharmacological target for diseases associated with stem cell dysfunction and cancer biology.FZD7 is also upregulated in subsets of colon, pancreatic and gastric tumours, therefore Fz7-21 serves as a pharmacological probe to explore further the function of FZD7 in stem cell and cancer biology.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.</p>Peso molecolare:2,110.8 g/molH-YALYDATYETK^-OH
<p>Peptide H-YALYDATYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASANLAATK^-OH
<p>Peptide H-ASANLAATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myelin PLP (103-116)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C63H108N16O20SPeso molecolare:1,440.77 g/molH-KLVVVGAVGV^-OH
<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHGQDYLVGNK^-OH
<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>TAPI-1
<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EBV BRLF-1 148-156 (HLA-A*03:01)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:TKSVY2Peso molecolare:1,143.3 g/molAngiotensin I, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C62H89N17O14Peso molecolare:1,296.5 g/molH-VLEAELL^VLR^-OH
<p>Peptide H-VLEAELL^VLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
