Peptidi

Peptide H-VSKTETSQVAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NPQLCYQDM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WIRDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IIGDIRQAHCNISRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IGNIILEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ELRDKKQKVHALFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LQVTDSGLYRCVIYHPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLGAFSDGLAHLDNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TSESGELHGLTTEEEFVEGIYKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-CGKGLSATVTGGQKGRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LTNYSVTDLNVQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LDKNKDPLNETV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VYYGVPVWKEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-HYEGSTVPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALAETCQNAWA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-PFPQPELPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AIEDYINEFSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AATVGSLAGQPLQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SGFSSVSVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YNGIITDTIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GYDTKQEDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IAGNSAYEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MSSYAFFVQTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FPEVDVLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DCKTILKAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GPGVRYPLTFGWCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-PVGRLVTVNPFVSVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RCQIFANI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALLTSRLRFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GWYTSVITIELSNIKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AEMWYSEVEEARRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EFTPQMQAAYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GFNKLRSTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MLLSKINSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSGRSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ISQAVHAAHAEINEAGRC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MLTELEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LMGYIPLVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLTPELYAELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LGANSLLDLVVFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QQPQQPFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SHLVEALYLVAGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GKKKYMLKHVVWAAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FFFNIFTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KLQCVDLHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GLKGPDIYKGVYQFKSVEFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TVPWPNASL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EVVLLVATEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLATQPPRTPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SYIGSINNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KNYIFEEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VSDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SADTLWGIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RFVFGTTPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VPQTPLHTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ASGNLIPQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IMYNYPAML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KENALLRYLLDKDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LHDFRHQIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YPHTHLVQQANPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VISPSEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TYLPAVDEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSPRWYFYYLGTGPEAGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GTYHTNEAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-HWESAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LGHPDTLNQGEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GAPINSATAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GPISGHVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTVFPIGIGDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NYTPGPGVRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FLYDRLAST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NNPFYFPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TFYVDGAANRETKIGKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GGKKKYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MVGGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LVVVGAGCVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IEIYPTSLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KAVRLIKFLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LPHNHTDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LFLEPIGADIALLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALGFENATQALGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ITCPPPMSVEHADIWVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EITFHGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ATEHLSTLSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LAQAYYESTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GTPGPQGIAGQRGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LNILNNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ETEVIDPQDLLEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-CSADNSHHYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TLDTLTAFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RTVPSGPDPLHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YSMKETTMKIIPFNRLSIG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VHLTPVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TEAPSATGQASSLLGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FEEIPEEYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SNICR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VEHSDLSFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AMMARDTAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AHQLAIDTYQEFEETYIPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LQDAEIAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DYQRLN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MDILSYMR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ATFQTPDFIVPLTDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-STQSAIDQITGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IFYNQQSHYDGTTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-HERNGFTVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KEADPTGHSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-HPVHAGPIAPGQMRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LLIYYTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SHTLYTHITPDAVPQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-CAPPGYALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSRLSNRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MGVADLIKKFESISKEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NPQLCYQDTILWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WPTLQWA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLLSEFCRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TLYLQMNSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VNYDFTIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LANFLVHSSNNFGAILSSTNVGSNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iveriotoxin on various ion channels and receptors. This product is available as a 0.1mg vial.

Ghrelin is a 28 amino acid peptide hormone that has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This product is available in the trifluoroacetate salt form and as a 0.1mg vial.

100-200mesh, 1% DVB.  Typical substitution 0.45meq/g

LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seem with vitamin D treatment for Covid-19.This peptide contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

Actinonin is a natural product with antimicrobial activity. It inhibits the growth of bacteria by binding to their ribosomes and inhibiting protein synthesis. Actinonin has been shown to inhibit the growth of gram-positive species such as Streptococcus pyogenes, group A beta-hemolytic streptococci, and Enterococcus faecalis. Actinonin also inhibits a number of enzymes including target enzymes for antimicrobial agents such as penicillin and erythromycin. Actinonin has been shown to be a potential biomarker for bowel disease in humans by its ability to bind to mitochondria in cells from patients with inflammatory bowel disease. This compound binds to basic proteins, which are found in high concentrations in the cell nucleus of organisms including humans.

Fmoc-3, Iodo-L-Tyr-OH is a building block used in the synthesis of peptides. This compound is a protected form of L-tyrosine that can be labeled with iodide and reacted with an amino acid or other organic molecule to produce a peptide. Fmoc-3, Iodo-L-Tyr-OH can also be used for radiolabeling, labeling, and death studies. The neurotransmitter dopamine has been detected in Fmoc-3, Iodo-L-Tyr-OH by electrophysiology. This compound is also used as an excitotoxic tool to study neuronal cell death.

The peptide Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-MCA is a synthetic, nonapeptide analog of the vasoactive intestinal peptide (VIP). It inhibits the activity of protein interactions, activator, and ligand. Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-MCA is used as a research tool for studying the structure and function of ion channels and receptors. This product is available in high purity and can be used in biological research.

Boc-Trp(Hoc)-OH is a peptide that binds to the C-terminus of the protein N-ethylmaleimide sensitive factor (NSF) and inhibits NSF. Boc-Trp(Hoc)-OH has been shown to inhibit ion channels, protein interactions, and receptor activity. It is an inhibitor of the phospholipase A2 enzyme and can be used as a pharmacological tool for research in cell biology and pharmacology.

Ac-Leu-Glu-His-Asp-MCA is a synthetic peptide that is used as a research tool. The peptide has been shown to bind to the alpha subunit of the nicotinic acetylcholine receptor, which is responsible for binding acetylcholine and transmitting nerve impulses. Ac-Leu-Glu-His-Asp-MCA activates the receptor by mimicking the effects of acetylcholine. Acetylcholine binding to the alpha subunit causes an influx of sodium ions into the cell, which leads to depolarization and an action potential. This synthetic peptide also binds to other types of receptors, including those for serotonin, dopamine, and adrenaline. Acetylcholine binding to these receptors leads to neurotransmitter release.

Lugdunin is a synthetic antibiotic that has been shown to inhibit the growth of bacteria by binding to the cell membrane. This binding causes a change in membrane potential, leading to inhibition of bacterial growth and death. Lugdunin is effective against Staphylococcus aureus, including methicillin-resistant strains, and has been found to be safe for use in humans. It is also active against other Gram-positive bacteria such as Streptococcus pneumoniae and Enterococcus faecalis. The enantiomer of lugdunin does not have antibacterial activity.

Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are essential for compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4 lysine rich tail plays a role in the higher order chromatin folding.Acetyl-Histone H4 (1-23)-GG-[Lys(5-FAM)] has a C-terminal GGK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. Additionally, the peptide has an uncharged C-terminal amide and is protected from N-terminal modifications by a covalently bonded acetyl group.

MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH₂ is a peptide that is a potent inhibitor of the potassium channel Kv1.3. It binds to the N terminus of the channel and blocks it, preventing voltage gating. MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH₂ is used in research as a tool to study ion channels and as an antibody for immunofluorescence studies.

H-Glu(His-OH)-OH is a protein, which can be found in the plasma samples of patients with fatty acid metabolism disorders. It is one of the most selective markers for identifying these disorders and has been extensively used for profiling and genomic analyses. H-Glu(His-OH)-OH is also present in rat cerebral cortex and it has been shown to be statistically significantly elevated in cerebral cortex samples from patients with Alzheimer's disease. This protein has been observed to have an acidic property and can be used as a biomimetic marker. Regression analysis has shown that H-Glu(His-OH)-OH levels are correlated with the severity of neuronal damage. This protein may serve as a biomarker for different diseases, including Parkinson's disease, Huntington's disease, or amyotrophic lateral sclerosis (ALS).

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM17 antibody, catalog no. 20R-1091

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF364 antibody, catalog no. 70R-2797

A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-F antibody, catalog no. 70R-6432

A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1C1 antibody, catalog no. 70R-10004

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB1 antibody, catalog no. 20R-1061

A synthetic peptide for use as a blocking control in assays to test for specificity of NTRK3 antibody, catalog no. 70R-7122

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653428 antibody, catalog no. 70R-9057

Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.
INSULIN CAN BE USED TO:
- Measure blood sugar levels
- Monitor diabetes
- Treat diabetes
- Control weight gain
- Improve muscle mass

RBP4 is a member of the retinol binding protein family. It binds to the retinoid X receptor, which is involved in ligand-dependent transcriptional regulation of gene expression. RBP4 has been shown to act as an inhibitor and activator of several different proteins, such as ion channels and receptors. It has also been used as a research tool for studying protein interactions, with high purity. RBP4 is used for life science research and antibody production.

CD20 (188-196) is a short part of a membrane phosphoprotein, CD20, which is expressed on the surface of B cells. CD20 receptor is an important target for immunotherapy against B cell lymphoma. CD20 epitopes are used in antibodies CD20 production, such as the production of the first monoclonal antibody to be approved for the treatment of lymphoma.
Applications of CD20 (188-196):
CD20 (188-196) is involved in research to generate cytotoxic T lymphocytes and stimulate CTL responses against B cell diseases. The production of specific T cells and IFN-γ are quantified by ELISPOT. CD20 (188-196) has been identified as a highly immunogenic HLA-A2 restricted peptide. Results suggest that CD20 (188-196) may serve in immunotherapeutic strategies especially for vaccine development against certain type of blood cancer.
CD20 (188-196) is also used in research on cell therapy as target for T cell receptor. In fact, T cells are modified in vivo to express specific T cell receptor and then inject modified cells in B cells cancer patient in order to recognized malignant B cells and treat them.

Portion of EBV

FRETS-25Ala is an inhibitor of the G protein-coupled receptor that inhibits the activation of the receptor. It is a peptide with a molecular weight of 1206.5 Da and a purity of 99.2%. FRETS-25Ala binds to the receptor and prevents it from interacting with other proteins, including G proteins. This inhibition leads to decreased activity in ion channels, which are responsible for transmitting electrical signals in cells. FRETS-25Ala can be used as a research tool to study cell biology and pharmacology.

Cathelicidin antimicrobial peptide, human, recombinant is a recombinant peptide that has been artificially synthesized. This peptide functions as an antimicrobial to inhibit the growth of bacteria by binding to cellular membranes and disrupting their integrity. Cathelicidin antimicrobial peptide, human, recombinant is expressed in extracellular fluids and functions as chemotaxis and n-terminal signal peptides. The molecular mass of cathelicidin antimicrobial peptide, human, recombinant is 17 kDa. It is active against Escherichia coli, but not against other organisms such as yeast or protozoa. Cathelicidin antimicrobial peptide, human, recombinant also has an inflammatory response in the body (e.g., fever).

TentaGel; is a gelatinous resin, an important support for solid phase synthesis. TentaGel; resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix.
These resins are designed for single bead synthesis and single bead analysis (mean particle size 280-320 µm: capacity 02-03 meq/g) and substitutional functional group: -CH2-CH2-SH.

Portion of Influenza NP

Portion of HCMV

Blocker of tetrodotoxin-sensivite channels

Myoglobin
Myoglobin 137-148 MHC II DRB1*03:01 is a short part of Myoglobin. Myoglobin is protein which binds oxygen or also iron in the skeletal muscle tissue.
Myoglobin 137-148 MHC II DRB1*03:01
Myoglobin 137-148 MHC II DRB1*03:01 is a classical peptide reference for the binding avec MHC II DRB1*03:01. Myoglobin 137-148 is often used to be in competition for study of the relative binding affinity.

Biotin-Ova (323-339) is the N-ter biotinylated version of Ova (323-339). Biotin-Ova (323-339) can be used in the analysis of antigen-specific T cells. Ovalbumin protein:
Ova (323-339) is an epitope of interest of the egg white albumen, which is widely used in allergy research. Ovalbumin is a glycoprotein that is sufficiently large and complex to be mildly immunogenic. Indeed, it has been demonstrated that Ovalbumin contains B-cell epitopes which are recognized by specific IgE antibodies and CD4 T cell epitopes restricted by the MHC I-Ad molecule in mice and by HLA-D molecule in human.
Applications of Ova (323-339):
Ova (323-339) allows to study bindings of class II MHC-peptide and T-cell activation in PBMCs by ELISPOT assays. In fact, this method quantifies peptide epitope specificity and IFN-γ releasing effector cells. It has been shown that Ova (323-339) was responsible for 25-35% of T-cell response of isolated BALB/c mouse. An investigation has demonstrated that Ova and Ova (323-339) induced similar lung inflammation and a Th2-like dominant immune response in mouse model.
Sequence: Biotin-ISQAVHAAHAEINEAGR

Secondary SIL peptide for Emicizumab  detection and quantification

Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Biotin-MAGE-A2 (157-166) is the N-ter biotinylated version of MAGE-A2 (157-166). Biotin-MAGE-A2 (157-166) can be used in the analysis of antigen-specific T cells. MAGE-A2 protein:
MAGE-A2 (157-166) is an epitope of Melanoma Antigen Gene A2 and is one of the most Cancer-Testis Antigens (CTA) overexpressed in tumors of different histological types, such as prostate cancer. Type of MAGE-A expressed in tumors cells varies according to the type of tumor. The expression of MAGE-A2 causes the proliferation of prostate cancer cells and decreases the chemosensitivity.
Applications of MAGE-A2 (157-166):
MAGE-A2 (157-166) is used to stimulate specific immune response, cytotoxic T cell response and to analyze the cytokine production in PBMCs by ELISPOT assay. In transgenic mouse, it has been demonstrated that MAGE-A2 (157-166) was capable of eliciting a CTL response presented by HLA-A*02:01 molecules. MAGE-A2 (157-166) has been reported to elicit CTL that could lyse tumor cell expressing both HLA-A*02:01 and MAGE-A2 by stimulation of peripheral blood mononuclear cells (PBMCs) with MAGE-A2 (157-166).
Sequence: Biotin-YLQLVFGIEV

Selective blocker of SK2 (KCa2.2) channels

SARS-CoV-2 Spike RBD 371-394 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 371-394 peptide is useful for vaccine development and for structure-activity relationship studies
SARS-CoV-2 Spike (S) glycoprotein
Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.
With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.
SARS-CoV-2 Spike RBD:
The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.
SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 371-394 (Biotin-LC) peptide