Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 29608 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Laminin (925-933)
CAS:Laminin 925-933 is a peptide originating from residues 925-933 of the laminin B1 chain, known for its binding affinity to the laminin receptor.Formula:C40H62N12O14SPurezza:98%Colore e forma:SolidPeso molecolare:967.06Ac-IEVDIDVEH (TFA)
Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.Formula:C50H76F3N11O21Purezza:98%Colore e forma:SolidPeso molecolare:1224.19Tyr-Somatostatin-14
CAS:Tyr-Somatostatin-14 is a modified peptide incorporating an additional Tyrosine (amino acid) into the structure of Somatostatin-14.Formula:C85H113N19O21S2Purezza:98%Colore e forma:SolidPeso molecolare:1801.05Super Fluor 750, SE
Super Fluor 750, SE: a dye for labeling antibodies, proteins, tracers, optimized for cell detection.Purezza:98%Colore e forma:SolidNeurotensin-related hexapeptide
CAS:Neurotensin hexapeptide in pigeon retinal cells may serve as a neuroactive agent.Formula:C36H58N8O9Purezza:98%Colore e forma:SolidPeso molecolare:746.89C14TKL-1 TFA
Endogenous human tachykinin-like peptide and potent agonist for NK1 receptors (EC50 = 1 nM).Formula:C63H98N20O13S2Purezza:98%Colore e forma:SolidPeso molecolare:1406.7Leucopyrokinin
CAS:Leucopyrokinin is a myotropic neuropeptide.Formula:C42H66N12O12Purezza:98%Colore e forma:SolidPeso molecolare:931.05Protein Kinase C (19-31) (TFA)(121545-65-1,free)
Protein Kinase C (19-31) TFA is a serine-modified PKCa-derived inhibitor for testing PKC activity.Formula:C69H119F3N26O18Purezza:98%Colore e forma:SolidPeso molecolare:1657.84SNAP-25 187-203
Amino acids 187-203 from SNAP-25's C-terminal helix can restore exocytosis in BoNT/E-affected cells at high doses.Formula:C71H125N27O26Purezza:98%Colore e forma:SolidPeso molecolare:1772.92Nifalatide
CAS:Nifalatide is a analog of enkephalin.Formula:C30H39N7O9SPurezza:98%Colore e forma:SolidPeso molecolare:673.74EGF Receptor Substrate 2 Phospho-Tyr5
EGF Receptor Substrate 2 (Phospho-Tyr5) is a biologically active peptide derived from an autophosphorylation site (Tyr992) of EGFR.Formula:C54H82N13O24Purezza:98%Colore e forma:SolidPeso molecolare:1328.28AF1 Neuropeptide
CAS:AF1 Neuropeptide, known as a sequenced bioactive neuropeptide, was seperated from the nematode Ascaris suum.Formula:C45H69N13O10Purezza:98%Colore e forma:SolidPeso molecolare:952.11Peptide M acetate
Peptide M acetate is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen:Formula:C83H145N21O33Purezza:98.96%Colore e forma:SolidPeso molecolare:1965.16[Glu1]-Fibrinopeptide B
CAS:[Glu1]-Fibrinopeptide B, from human fibrinogen Bβ-chain (1-14), is created by thrombin and activates PMN, monocytes, fibroblasts.Formula:C66H95N19O26Purezza:98%Colore e forma:SolidPeso molecolare:1570.6AMARA peptide TFA (163560-19-8 free base)
AMARA peptide (TFA) is a substrate for salt-induced kinase (SIK) and adenosine activated protein kinase (AMPK).Formula:C64H116F3N27O18SPurezza:98%Colore e forma:SolidPeso molecolare:1640.84GIP (1-30) amide (Human) (TFA)
GIP (1-30) amide (Human) TFA: Incretin hormone fragment that boosts insulin secretion and lowers post-meal blood sugar.Formula:C164H241F3N40O49SPurezza:98%Colore e forma:SolidPeso molecolare:3645.97Colivelin TFA (867021-83-8 free base)
CAS:Colivelin (TFA) is a hybrid peptide composed of ADNF and AGA-(C8R)HNG17, a potent Humanin (HN) derivative.Formula:C121H207F3N32O37Purezza:98%Colore e forma:SolidPeso molecolare:2759.13Cyclo(L-Pro-L-Val)
CAS:Cyclo(L-Pro-L-Val), from Mycobacterium spp., has anti-inflammatory effects, hinders phytopathogens, and suppresses IKKα, NF-κB, iNOS, and COX-2 activation.
Formula:C10H16N2O2Purezza:98.18%Colore e forma:SolidPeso molecolare:196.25Laminin (925-933)(TFA) (110590-60-8 free base)
Laminin (925-933) (TFA) is a peptide derived from residues 925-933 of the Laminin B1 chain that binds to the laminin receptor.Formula:C42H63F3N12O16SPurezza:98%Colore e forma:SolidPeso molecolare:1081.08Lagatide
CAS:Lagatide is a synthetic heptapeptide that has antisecretory activity.Formula:C33H58N10O9Purezza:98%Colore e forma:SolidPeso molecolare:738.88C-Peptide, dog
CAS:Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.Formula:C137H225N37O49Purezza:98%Colore e forma:SolidPeso molecolare:3174.47SP-346 nonapeptide
CAS:SP-346 nonapeptide is a pipecolic acid substituted nonapeptide.Formula:C48H77N13O14Purezza:98%Colore e forma:SolidPeso molecolare:1060.221PKC ζ pseudosubstrate
Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.Formula:C208H336N74O44S3Purezza:98%Colore e forma:SolidPeso molecolare:4673.59[Pro3]-GIP (Rat)
Rat GIP receptor partial agonist with Kd of 13 nM, boosts cAMP in COS-7 cells, competitively antagonizes GIP.Formula:C226H343N61O64SPurezza:98%Colore e forma:SolidPeso molecolare:4970.63Xenopsin TFA (51827-01-1 free base)
Xenopsin TFA, a neurotensin-like octapeptide from Xenopus skin, inhibits gastric acid secretion.Formula:C49H74F3N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1094.19LAH4 acetate
LAH4 acetate is the α-helical structure of the designed amphoteric peptide antibiotic, which is capable of complexing DNA, associating with the cell surface
Formula:C134H232N38O29Purezza:98.41%Colore e forma:SoildPeso molecolare:2839.51Tetrapeptide-2
CAS:Tetrapeptide-2 is an amino acid peptide.
Formula:C24H37N5O8Purezza:98%Colore e forma:SolidPeso molecolare:523.58Alisporivir intermediate-1
CAS:Alisporivir intermediate-1: Key for synthesizing Alisporivir, used against inflammation and viruses.
Formula:C74H132N12O17Purezza:98%Colore e forma:SolidPeso molecolare:1461.91NEP(1-40)
CAS:Nogo-66 (1–40) peptide blocks NgR, enhances axonal growth, and aids spinal recovery, but doesn't affect MAG inhibition.Formula:C206H324N56O65Purezza:98%Colore e forma:SolidPeso molecolare:4625.16CysHHC10 TFA(1408311-03-4 free base)
CysHHC10 TFA is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria.Formula:C79H108F3N23O12SPurezza:98%Colore e forma:SolidPeso molecolare:1660.91[Arg8]-Vasotocin TFA (113-80-4 free base)
[Arg8]-Vasotocin (TFA) is a nonmammalian vertebrate neurohypophyseal peptide.Formula:C45H68F3N15O14S2Purezza:98%Colore e forma:SolidPeso molecolare:1164.24Super-TDU (1-31) TFA
Super-tdu (1-31) TFA is an endogenous ligand of heptapeptide receptor and has a strong anti-analgesic effect.
Formula:C141H218N40O48·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3355.5p2Ca
CAS:p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.Formula:C47H66N8O12Purezza:98%Colore e forma:SolidPeso molecolare:935.07Pressinoic Acid
CAS:Pressinoic Acid is a peptide with potent corticotrophin-releasing activity. It is also an oxytocin inhibitor; it induces maternal behavior.Formula:C33H42N8O10S2Purezza:98%Colore e forma:SolidPeso molecolare:774.86β-Secretase inhibitor-STA
CAS:BACE-IN-1 is amyloid precursor protein beta-secretase inhibitor
Formula:C73H118N16O27Purezza:98%Colore e forma:SolidPeso molecolare:1651.81BDS I
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels.Formula:C210H297N57O56S6Purezza:98%Colore e forma:SolidPeso molecolare:4708.37Recanaclotide
CAS:Recanaclotide can be used to treat Gastroparesis, Functional Dyspepsia, and Other Gastrointestinal Disorders.Formula:C45H71N14O20PS6Purezza:98%Colore e forma:SolidPeso molecolare:1351.49BNP-45 (rat) (TFA) (123337-89-3 free base)
BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.Formula:C215H350N71O67F3S3Purezza:98%Colore e forma:SolidPeso molecolare:5154.692: PN: US20040072744 SEQID: 2 claimed protein
CAS:2: PN: US20040072744 SEQID: 2 claimed protein is a synthetic peptide, used for the research of Down' syndrome and schizophrenia.
Formula:C43H67N13O17SPurezza:98%Colore e forma:SolidPeso molecolare:1070.13Acetyl-Calpastatin (184-210)(human) acetate
Acetyl-Calpastatin acetate inhibits µ-calpain (Ki=0.2nM) and cathepsin L (Ki=6μM) selectively and reversibly.
Formula:C144H234N36O46SPurezza:97.84% - 98.16%Colore e forma:SolidPeso molecolare:3237.68pp60 c-src (521-533) (phosphorylated)
CAS:Peptide binds pp60c-src/v-src SH2, inhibiting kinase, phosphorylated at Tyr527.Formula:C62H95N16O28PPurezza:98%Colore e forma:Lyophilized PowderPeso molecolare:1543.5G3-C12 TFA (848301-94-0 free base)
G3-C12 TFA Salt is a specific galectin-3 binding peptide with Ksubdsub of 88 nM and shows anticancer activity.Formula:C74H115N23O23S2·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:1873[pSer2, pSer5, pSer7]-CTD
CAS:[pSer2, pSer5, pSer7]-CTD, phosphorylated at RNA Pol II CTD ser2/5/7, is a CDK7 substrate.Formula:C96H137N21O37Purezza:98%Colore e forma:SolidPeso molecolare:2177.23[pThr3]-CDK5 Substrate (TFA)
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM.Formula:C55H101F3N15O17PPurezza:98%Colore e forma:SolidPeso molecolare:1332.45V5 Epitope Tag Peptide Trifluoroacetate
V5 Epitope Tag Peptide Trifluoroacetate is a Tag Peptide derived from a small Epitope on P and V proteins of monkey-virus paramyxovirus.Formula:C64H108N16O20·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:1535.66CGRP II, rat (TFA) (99889-63-1 free base)
Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) is a neuropeptide with 37 amino acid.Formula:C165H268F3N51O52S2Purezza:98%Colore e forma:SolidPeso molecolare:3919.33Arg-Gly-Asp-Cys
CAS:Arg-Gly-Asp-Cys is the binding motif of fibronectin and cell adhesion molecules, which can inhibit platelet aggregation and fibrinogen binding.Formula:C15H27N7O7SPurezza:98%Colore e forma:SolidPeso molecolare:449.48Suc-Leu-Leu-Val-Tyr-AMC
CAS:Suc-Leu-Leu-Val-Tyr-AMC is a fluorescent substrate for the 20S proteasome, other chymotrypsin-like proteases.Formula:C40H53N5O10Purezza:98%Colore e forma:SolidPeso molecolare:763.88δ-Theraphotoxin-Hm1b
δ-Theraphotoxin-Hm1b, a 42-amino acid peptide derived from the Togo starburst tarantula (Heteroscodra maculata) venom, selectively inhibits the inactivation ofFormula:C169H241N45O50S6Purezza:98%Colore e forma:SolidPeso molecolare:3895.38NH2-KLGADTDGEQDQHMTYGGQ-COOH
NH2-QGGYTMHQDQEGDTDAGLK-COOH is a synthetic peptide chain consisting of a primary amine group attached to lysine and a carboxyl group attached to glutamine.Formula:C83H127N25O34SPurezza:98%Colore e forma:SolidPeso molecolare:2051.11Z-VRPR-FMK trifluoroacetate salt
Irreversible MALT1 inhibitor; dose-dependent T cell activation block and Bcl-10 cleavage reduction; decreases Jurkat cell-fibronectin adhesion; cell-permeable.Formula:C31H49FN10O6·CF3CO2HPurezza:98%Colore e forma:SolidPeso molecolare:790.81Apelin-13 TFA (217082-58-1 free base)
Apelin-13 is an endogenous ligand of APJ receptor, and the EC 50 value of activated G protein coupled receptor is 0.37 nM.Formula:C71H112F3N23O18SPurezza:98%Colore e forma:SolidPeso molecolare:1664.85PGLa TFA (102068-15-5 free base)
PGLa TFA is a cationic antimicrobial peptide (AMP) originally isolated from frog. It has been shown to have antibacterial,antifungal,and antiviral,activities.Formula:C90H163F3N26O24SPurezza:98%Colore e forma:SolidPeso molecolare:2082.47pGlu-Pro-Arg-MNA
CAS:pGlu-Pro-Arg-MNA is a chromogenic substrate.Formula:C23H32N8O7Purezza:98%Colore e forma:SolidPeso molecolare:532.55Neuropeptide S (human)
CAS:Endogenous neuropeptide S receptor agonist, EC50 = 9.4 nM; boosts wakefulness and activity, lowers anxiety in mice.Formula:C93H155N31O28SPurezza:98%Colore e forma:SolidPeso molecolare:2187.5S961 TFA (1083433-49-1 free base)
S961 TFA: Insulin receptor antagonist; IC50: hir-a 0.048 nM, hir-b 0.027 nM, higf-ir 630 nM.Formula:C211H297N55O71S2·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:N/AMini Gastrin I, human TFA (54405-27-5 free base)
Mini Gastrin I, human (TFA) is short for human Gastrin. It is a mother peptide composed of 5-17 amino acids.Formula:C76H100F3N15O28SPurezza:98%Colore e forma:SolidPeso molecolare:1760.75Ac-VDID (TFA)
Ac-VDID TFA is a short peptide sequence with Ac at the end.Formula:C23H35F3N4O12Purezza:98%Colore e forma:SolidPeso molecolare:616.54TNF-α (46-65), human TFA (144796-72-5 free base)
TNF-α (46-65), human (TFA) is a peptide of human TNF-α.Formula:C112H173F3N24O32Purezza:98%Colore e forma:SolidPeso molecolare:2424.71Alicdamotide
CAS:Alicdamotide is a bioactive chemical.Formula:C54H80N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1133.3β-Amyloid(1-14),mouse,rat
Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide. This peptide is amino acids 1 to 14 fragment of Beta-Amyloid peptide.
Formula:C69H95N21O24Purezza:98%Colore e forma:SolidPeso molecolare:1603.7BDC2.5 mimotope 1040-31
CAS:Mimotope 1040-31 agonizes diabetogenic BDC2.5 T-cells, specifically targets BDC2.5 TCR Tg+ cells, known as p31.Formula:C63H97N17O14SPurezza:98%Colore e forma:SolidPeso molecolare:1348.61Ziconotide TFA (107452-89-1 free base)
Ziconotide TEA blocks N-type calcium channels on pain pathway neurons, dampening synapse activity and providing strong pain relief.Formula:C116H179F21N36O46S7Purezza:98%Colore e forma:SolidPeso molecolare:3437.3BAD (103-127) (human) acetate
BAD (103-127) (human) acetate is a 25-mer Bad polypeptide from the BAD BH3 domain that antagonizes the effects of Bcl-xl.Formula:C139H216N42O41SPurezza:96.97%Colore e forma:SolidPeso molecolare:3163.52TAT-amide
CAS:TAT-amide is a CPP that enters cells, with short amino acids to penetrate membranes.Formula:C64H119N33O13Purezza:98%Colore e forma:SolidPeso molecolare:1558.84SDKPDMAEIEKFDKSK acetate
SDKPDMAEIEKFDKSK acetate, a Thymosin β4 derivative, blocks Akt to inhibit PDGF-BB-driven fibrogenesis and HSC proliferation/migration.
Formula:C82H134N20O31SPurezza:99.04%Colore e forma:SolidPeso molecolare:1928.12PEN-221
CAS:PEN-221 targets SSTR2; it's a cytotoxic conjugate with DM1 and Tyr3-octreotate, IC50 of 10 nM.Formula:C83H109ClN14O20S4Purezza:98%Colore e forma:SolidPeso molecolare:1786.55Glipentide
CAS:Glieptide, a second-generation sulfonylurea, promotes the accumulation of fructose 2, 6-diphosphate in liver cells.Formula:C22H27N3O5SPurezza:98%Colore e forma:SolidPeso molecolare:445.53TAT 2-4
CAS:TAT 2-4, an HIV-1 Tat protein peptide, efficiently delivers diverse cargoes, from particles to biomolecules.Formula:C132H240N66O29Purezza:98%Colore e forma:SolidPeso molecolare:3215.74MCH (salmon) TFA (87218-84-6 free base)
MCH, a 19 amino acid peptide in the hypothalamus, regulates arousal, behavior, and food intake in mammals.Formula:C91H140F3N27O26S4Purezza:98%Colore e forma:SolidPeso molecolare:2213.5Corticotropin-releasing factor (human)
CAS:Human CRF is a neuropeptide that releases ACTH, stimulates the nervous system, and antagonizes inflammation.Formula:C208H344N60O63S2Purezza:98%Colore e forma:SolidPeso molecolare:4757.45MART-1 (26-35) (human) TFA (156251-01-3 free base)
MART-1 (26-35) (human) TFA is an amino acid residue of 26-35 protein.Formula:C44H75F3N10O16Purezza:98%Colore e forma:SolidPeso molecolare:1057.12WL 47 - dimer
High affinity caveolin-1 (CAV1) ligand (Kd = 23 nM); disrupts caveolin-1 oligomers. Exhibits selectivity for CAV1 over BSA, casein and HEWL.Formula:C80H130N24O18S4Purezza:98%Colore e forma:SolidPeso molecolare:1844.3Pentasarcosyl angiotensin II
CAS:Pentasarcosyl angiotensin II is a synthetic analog of angiotensin II.Formula:C65H96N18O17Purezza:98%Colore e forma:SolidPeso molecolare:1401.57Thioredoxin reductase peptide TFA
Thioredoxin reductase peptide TFA corresponds to residues 53-67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research..Formula:C68H107F3N18O20S2Purezza:98%Colore e forma:SolidPeso molecolare:1617.81Agavoside H
CAS:Agavoside H is a biochemical.Formula:C68H112O37Purezza:98%Colore e forma:SolidPeso molecolare:1521.607Platelet Factor 4 (58-70), human
CAS:Platelet Factor 4 (58-70), human is a polypeptide based on the 58-70 amino acid sequence of Platelet Factor 4 (pf-4) residues.Formula:C76H133N17O18Purezza:98%Colore e forma:SolidPeso molecolare:1572.97Agavoside E
CAS:Agavoside E is a biochemical.Formula:C62H100O31Purezza:98%Colore e forma:SolidPeso molecolare:1341.451Lliumoside C
CAS:Lliumoside C is a bioactive chemical.Formula:C63H104O31Purezza:98%Colore e forma:SolidPeso molecolare:1357.494Gap19 TFA (1507930-57-5 free base)
Gap19 TFA is a peptide derived from nine amino acids of Cx43 cytoplasmic ring (CL), an effective, selective connexin 43 (Cx43) half-channel blocker.Formula:C57H97F3N14O15Purezza:98%Colore e forma:SolidPeso molecolare:1275.46Ac2-26 TFA (151988-33-9 free base)
Ac2-26 TFA reduces acute lung injury and AnxA1 expression, blocks NF-κB and MAPK in lung ischemia-reperfusion.Formula:C143H211F3N32O46SPurezza:98%Colore e forma:SolidPeso molecolare:3203.45Sarasinoside A1
CAS:Sarasinoside A1 is a triterpenoid saponin that reverses mesenchymal tumor transformation.Formula:C62H100N2O26Purezza:98%Colore e forma:SolidPeso molecolare:1289.47Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a cell-permeable, non-toxic inhibitor that irreversibly binds to activatedFormula:C43H45FN4O16Purezza:98%Colore e forma:SolidPeso molecolare:892.83HIF-1 α (556-574) (TFA)
HIF-1 alpha (556-574) TFA is a 19-residue fragment of hypoxia-inducible factor-1 (HIF-1), which serves as the master regulator of oxygen homeostasis [1].Purezza:98%Colore e forma:Odour SolidBio-Ben
Bio-ben functions as a sulfenic acid probe, utilized for labeling both free sulfenic acid and cysteine sulfenic acid within proteins and peptides.Formula:C17H22BN3O4SColore e forma:SolidPeso molecolare:375.20β-MSH (1-22) human TFA (17908-57-5 free base)
β-Melanocyte Stimulating Hormone (MSH) is a 22-residue human peptide acting as a melanocortin-4 receptor agonist.Formula:C120H175F3N34O37SPurezza:98%Colore e forma:SolidPeso molecolare:2774.94PD-1/PD-L1-IN 3 TFA (1629654-95-0 free base)
PD-1/PD-L1-IN 3 TFA inhibits the binding of human PD-1 to PD-Ll with an IC50 of 9 nM.Formula:C91H127F3N24O20SPurezza:98%Colore e forma:SolidPeso molecolare:1966.19TAT (48-57) TFA(253141-50-3,free)
TAT (48-57) (TFA) is a cellular permeability peptide derived from hiv-1 transcriptional activator (TAT) protein residue 48-57.Formula:C55H109N31O12·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:1510.67CTP-NBD
CAS:CTP-NBD is a cell-permeable, specific inhibitor of the NFκB peptide, which has been utilized in studies of colitis [1] [2].Formula:C121H194N46O32Purezza:98%Colore e forma:SolidPeso molecolare:2805.12Thioredoxin reductase peptide
CAS:TrxR peptide (53-67) aids TrxR research, has C-terminal selenylsulfide, similar to glutathione reductase.Formula:C66H106N18O18S2Purezza:98%Colore e forma:SolidPeso molecolare:1503.79Prepro VIP (111-122), human
CAS:Prepro VIP (111-122), human is a prepro-vasoactive intestinal polypeptide (VIP)–derived peptide, corresponding to residues 111-122.Formula:C53H87N13O21Purezza:98%Colore e forma:SolidPeso molecolare:1242.33ω-Conotoxin CVIA
CAS:ω-Conotoxin CVIA, a 27-amino acid neuropeptide, functions as a blocker of voltage-sensitive calcium channels (VSCCs) [1].Formula:C97H161N39O36S6Purezza:98%Colore e forma:SolidPeso molecolare:2641.95C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Formula:C37H62F3N13O12Purezza:98%Colore e forma:SolidPeso molecolare:937.96Exendin-4 peptide derivative acetate
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.Purezza:98%Colore e forma:SolidPeso molecolare:N/AGrTx1
GrTx1, a peptide toxin derived from Grammostola rosea spider venom, selectively inhibits sodium channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, and Nav1.7,Formula:C159H243N45O41S8Purezza:98%Colore e forma:SolidPeso molecolare:3697.43κM-Conotoxin RIIIK
CAS:κM-Conotoxin RIIIK is a potassium channel antagonist that inhibits voltage-activated potassium ion channels [1].Formula:C106H178N34O33S6Purezza:98%Colore e forma:SolidPeso molecolare:2649.15GnRH-I
GnRH-I, a 10-amino-acid peptide from the hypothalamus, regulates vertebrate reproduction and pulsates in the bloodstream.Formula:C50H75N17O13Purezza:98%Colore e forma:SolidPeso molecolare:1182.32mP6
CAS:mP6 (Myr-FEEERA-OH), a myristoylated peptide, selectively inhibits Gα 13's interaction with integrin β 3 while preserving talin-dependent integrin function.Formula:C47H75N9O14Purezza:98%Colore e forma:SolidPeso molecolare:990.15Fmoc N-hydroxysuccinimide ester
CAS:Formula:C19H15NO5Purezza:≥ 98.0%Colore e forma:White to off-white crystalline powderPeso molecolare:337.34Benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate
CAS:Formula:C18H28N6OP·PF6Purezza:≥ 97.5%Colore e forma:White to off-white or slightly yellow crystalline powderPeso molecolare:520.40GpTx-1
CAS:GpTx-1 exhibits potent selectivity as a NaV1.7 antagonist, demonstrating an inhibition concentration (IC50) of 10 nM [1].Formula:C176H271N53O45S7Purezza:98%Colore e forma:SolidPeso molecolare:4073.82FALGPA TFA
FALGPA, a colorimetric substrate for collagenase, exhibits selectivity over trypsin, thermolysin, and elastase.Formula:C23H32N4O7·XCF3COOHColore e forma:SolidPeso molecolare:476.52Ysdspstst peptide
CAS:Ysdspstst peptide is a biochemical.Formula:C38H57N9O19Purezza:98%Colore e forma:SolidPeso molecolare:943.91Tetrapeptide-5
CAS:Tetrapeptide-5 is a humectant or hydroscopic moisturizer.Formula:C18H26N8O6Purezza:98%Colore e forma:SolidPeso molecolare:450.45Secretin (33-59), rat TFA (121028-49-7 free base)
Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates pancreatic secretion of bicarbonate, enzymes, and K+.Formula:C131H217F3N42O44Purezza:98%Colore e forma:SolidPeso molecolare:3141.37Somatostatin
CAS:Somatostatin: a peptide hormone inhibiting growth hormone, insulin, and glucagon; secreted by hypothalamus and pancreatic D cells.Purezza:98%Colore e forma:PowderPeso molecolare:1637.88F-Chemotactic peptide-fluorescein
CAS:F-Chemotactic peptide-fluorescein is a fluorescent label.Formula:C64H76N8O14SPurezza:98%Colore e forma:SolidPeso molecolare:1213.41Beefy meaty peptide
CAS:Beefy meaty peptide is a bioactive chemical.Formula:C34H57N9O16Purezza:98%Colore e forma:SolidPeso molecolare:847.87Agavoside C
CAS:Agavoside C is a biochemical.Formula:C50H80O23Purezza:98%Colore e forma:SolidPeso molecolare:1049.167ATI-2341 TFA (1337878-62-2 free base)
ATI-2341 is a CXCR4 allosteric agonist, promoting Gi activation, inhibiting cAMP, mobilizing PMNs and HSPCs.Formula:C106H179F3N26O27S2Purezza:98%Colore e forma:SolidPeso molecolare:2370.84Trempamotide
CAS:Trempamotide is a bioactive chemical.Formula:C58H80N10O18Purezza:98%Colore e forma:SolidPeso molecolare:1205.31Dynamin inhibitory peptide, myristoylated (control)
Myristoylated control peptide inhibits dynamin GTPase, blocking its amphiphysin binding and preventing endocytosis, without affecting GABAA receptor IPSPs.Formula:C61H107N19O14Purezza:98%Colore e forma:SolidPeso molecolare:1330.64Men 10456
CAS:Men 10456 is a MEN 10376 derivative.Formula:C57H67N11O11Purezza:98%Colore e forma:SolidPeso molecolare:1082.21Locustamyotropin
CAS:Locustamyotropin is a novel peptide isolated from Leucophae maderae; stimulates the spontaneous contractions of the hindgut of Leucophaea maderae.Formula:C55H89N17O14Purezza:98%Colore e forma:SolidPeso molecolare:1212.4Cardiotoxin Analog (CTX) IV (6-12)
CAS:Cardiotoxin Analog (CTX) IV (6-12) is a part peptide of Cardiotoxin Analog (CTX) IV. Cardiotoxin analogues IV isolated from the venom of Taiwan Cobra.Formula:C48H70N10O7Purezza:98%Colore e forma:SolidPeso molecolare:899.13Angiotensin I, asn(1)-val(5)-gly(9)-
CAS:Angiotensin I, asn(1)-val(5)-gly(9)- is isolated from the plasma of American eel, Anquilla rostrata.Formula:C57H84N16O13Purezza:98%Colore e forma:SolidPeso molecolare:1201.38Tanurmotide
CAS:Tanurmotide is a bioactive chemical.Formula:C51H80N14O15SPurezza:98%Colore e forma:SolidPeso molecolare:1161.33Lys-phe-phe-phe-ile-ile-trp-och3
CAS:Lys-phe-phe-phe-ile-ile-trp-och3 is a hydrophobic peptide which reacts with lipid vesicles.Formula:C57H75N9O8Purezza:98%Colore e forma:SolidPeso molecolare:1014.26Pseudo RACK1
Protein kinase C activator linked to Antennapedia domain for cell entry; ensures quick uptake and intracellular release.Formula:C144H225N43O34S3Purezza:98%Colore e forma:SolidPeso molecolare:3198.81Conotoxin GII
CAS:Conotoxin GII is a highly toxic peptide.Formula:C57H81N19O16S4Purezza:98%Colore e forma:SolidPeso molecolare:1416.63M-2420
CAS:M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).Formula:C70H91N15O27Purezza:98%Colore e forma:SolidPeso molecolare:1574.56Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Formula:C26H51N3O5Purezza:98%Colore e forma:SolidPeso molecolare:485.7Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Formula:C100H149N31O23Purezza:98%Colore e forma:SolidPeso molecolare:2153.45OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFormula:C63H100N20O22Purezza:98%Colore e forma:SolidPeso molecolare:1489.59cAC 253
Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.Formula:C126H202N42O40S2Purezza:98%Colore e forma:SolidPeso molecolare:3009.36Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Formula:C44H71N11O12S2Purezza:98%Colore e forma:SolidPeso molecolare:1010.23Decabassianolide
CAS:Decabassianolide is a biochemical.Formula:C60H105N5O15Purezza:98%Colore e forma:SolidPeso molecolare:1136.52Knqdk peptide
CAS:Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.Formula:C25H45N9O10Purezza:98%Colore e forma:SolidPeso molecolare:631.68PYX 1
CAS:PYX 1 is an effective orexigenic peptide.Formula:C70H105Cl2N19O16Purezza:98%Colore e forma:SolidPeso molecolare:1539.61Lactoferrin (17-41) TFA (146897-68-9 free base)
Lactoferricin B (amino acids 17-41 of lactoferrin) enhances anti-fungal agents against Candida Albicans.Formula:C143H225F3N46O31S3Purezza:98%Colore e forma:SolidPeso molecolare:3237.79β-Casomorphin, human TFA (102029-74-3 free base)
β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) an opioid peptide that ACTS as an opioid receptor agonist.Formula:C46H62F3N7O13Purezza:98%Colore e forma:SolidPeso molecolare:978.02Bacterial Sortase Substrate III, Abz/DNP (TFA)
Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.
Formula:C43H58N11F3O16Purezza:98%Colore e forma:SolidPeso molecolare:1042.02GRGDSPC
CAS:GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.Formula:C25H42N10O11SPurezza:98%Colore e forma:SolidPeso molecolare:690.73VV-Hemorphin-7
CAS:VV-Hemorphin-7 is a morphinomimetic peptide.Formula:C59H82N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1195.37C-Reactive Protein (CRP) (77-82)
CAS:CRP 77-82 is a fragment of CRP, a pentameric, plasma protein that marks inflammation and cardiovascular risk, rising with IL-6 from macrophages/T cells.
Formula:C23H40N6O10Purezza:98%Colore e forma:SolidPeso molecolare:560.61Calcineurin substrate (TFA)
Calcineurin substrate (TFA), a polypeptide from the RII subunit of PKA, gauges Calcineurin activity.Formula:C94H151F3N28O31Purezza:98%Colore e forma:SolidPeso molecolare:2226.37D-loop peptide, synthetic
CAS:D-loop peptide, synthetic; antigenic; cycles via Asp10 side chain to terminal amide bond.Formula:C53H76N16O16SPurezza:98%Colore e forma:SolidPeso molecolare:1225.35Laminin B1 octapeptide P-8
CAS:Laminin B1 octapeptide P-8 is a synthetic laminin B1 chain octapeptide with laminin receptor binding ability.Formula:C43H67N13O15Purezza:98%Colore e forma:SolidPeso molecolare:1006.07OVA G4 peptide
CAS:G4 peptide (SIIGFEKL), a variant of ovalbumin epitope SIINFEKL, binds to mouse MHC class I H-2Kb.Formula:C43H71N9O12Purezza:98%Colore e forma:SolidPeso molecolare:906.08P110
CAS:Drp1 inhibitor blocks its GTPase, preserves mitochondrial function, and reduces ROS and cell death, aiding Parkinson's model.Formula:C100H179N45O25Purezza:98%Colore e forma:SolidPeso molecolare:2411.8AUNP-12 TFA (1353563-85-5 free base)
AUNP-12 TFA is a polypeptide that blocks PD-1, PD-L1, and PD-L2, safeguarding lymphocyte growth and function.Formula:C144H227F3N40O50Purezza:98%Colore e forma:SolidPeso molecolare:3375.63MARCKS Peptide(151-175), Phosphorylated
Myristoylated Alanine-Rich C Kinase Substrate peptide (151-175) is a high affinity Protein Kinase C substrate.
Formula:C147H246N41O40P3Purezza:98%Colore e forma:SolidPeso molecolare:3320.8Z-Gly-Gly-Arg-AMC
CAS:Z-Gly-Gly-Arg-AMC is a specific fluorogenic substrate utilized for assessing thrombin generation in Platelet-Rich Plasma (PRP) and Platelet-Poor Plasma (PPP),Formula:C28H33N7O7Purezza:98%Colore e forma:SolidPeso molecolare:579.6Leishmania peptide 183
CAS:Leishmania peptide 183 is an antigen.Formula:C44H74N14O18Purezza:98%Colore e forma:SolidPeso molecolare:1087.14WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Formula:C55H74N10O13SPurezza:98%Colore e forma:SolidPeso molecolare:1115.3JAG-1, scrambled
CAS:This peptide is a scrambled sequence of JAG-1(188-204).Formula:C93H127N25O26S3Purezza:98%Colore e forma:SolidPeso molecolare:2107.35Pentapeptide-4
CAS:Pentapeptide-4 is a matrikine utilized in anti-wrinkle cosmetics.Formula:C23H45N7O9Purezza:98%Colore e forma:SolidPeso molecolare:563.64BDC2.5 mimotope 1040-31 TFA(329696-49-3 free base)
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5.Formula:C65H98F3N17O16SPurezza:98%Colore e forma:SolidPeso molecolare:1462.63Trifluoroacetic acid, Ultrapure for synthesis
CAS:Formula:CF3CO2HPurezza:≥ 99.80%Colore e forma:Clear, colourless to faint yellow liquidPeso molecolare:114.02Exendin derivative 1
Exendin derivative 1 is a 39 amino acid peptide.Formula:C184H281N49O61SPurezza:98%Colore e forma:SolidPeso molecolare:4187.56Peptide 399
CAS:Peptide 399 is an antimicrobial peptide with an idealized amphiphilic alpha helix.Formula:C84H162N20O15Purezza:98%Colore e forma:SolidPeso molecolare:1692.345Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purezza:98%Colore e forma:SolidPeso molecolare:3692.15Neuromedin S(rat)
CAS:Endogenous agonist for NMU receptors (EC50: NMU1=65 pM, NMU2=91 pM), shifts locomotor circadian rhythm, suppresses appetite.Formula:C193H307N57O49SPurezza:98%Colore e forma:SolidPeso molecolare:4241.975-CR110 [5-Carboxyrhodamine 110] *Single isomer*
CR110 reagents are more photostable and pH-independent than FITC/FAM, with optimal absorption at 488 nm.Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81Peptide T amide
CAS:Peptide T amide is an octapeptide segment of HIV envelope gp120 and is used in AIDS therapy.Formula:C35H56N10O15Purezza:98%Colore e forma:SolidPeso molecolare:856.888CRF, bovine TFA (92307-52-3 free base)
CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.Formula:C208H341F3N60O65SPurezza:98%Colore e forma:SolidPeso molecolare:4811.36Latromotide
CAS:Latromotide is an antineoplastic agent.Formula:C60H105N17O12Purezza:98%Colore e forma:SolidPeso molecolare:1256.58Super-TDU (TFA) (1599441-71-0 free base)
uper-TDU is an inhibitory peptide targeting YAP-TEADs interaction.Formula:C239H371N66O71SPurezza:98%Colore e forma:SolidPeso molecolare:5393.96Alexamorelin Met 1
Alexamorelin Met 1, a heptapeptide, inhibits GH secretagogue binding.Formula:NAPurezza:98%Colore e forma:SolidPeso molecolare:622.68Relaxin C-peptide
CAS:Relaxin C-peptide, as a synthetic 14-amino acid peptide found in human decidua & placenta, can represent a partial sequence of human relaxin connecting peptide.Formula:C75H118N20O24Purezza:98%Colore e forma:SolidPeso molecolare:1683.885Gly-Phe-Arg
CAS:Gly-Phe-Arg is a highly potent synthetic tripeptide that mimics the pumping pheromone of the mud-crab.Formula:C17H26N6O4Purezza:98%Colore e forma:SolidPeso molecolare:378.43CGRP(83-119), rat
Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.Formula:C162H262N50O52S2Purezza:98%Colore e forma:SolidPeso molecolare:3806.3Cucumechinoside C
CAS:Cucumechinoside C is a bioactive natural chemical.
Formula:C54H86O28S2Purezza:98%Colore e forma:SolidPeso molecolare:1247.37Lophyrotomin
CAS:Lophyrotomin is a hepatotoxin isolated from the European Birch sawfly Arge pullata.Formula:C48H65N9O17Purezza:98%Colore e forma:SolidPeso molecolare:1040.08Semax
CAS:Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH) that has neuroprotective, analgesic, and anxiolytic properties.Formula:C37H51N9O10SPurezza:98%Colore e forma:SolidPeso molecolare:813.93Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Formula:C20H28F3N3O8Purezza:98%Colore e forma:SolidPeso molecolare:495.45Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Formula:C32H45N9O10SPurezza:98%Colore e forma:SolidPeso molecolare:747.82Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Formula:C52H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1186.32Acyl Carrier Protein (ACP) (65-74)
CAS:ACP (65-74) is a plastidial fatty acid synthetase fragment binding acyl groups with 4-phosphopantetheine.Formula:C47H74N12O16Purezza:98%Colore e forma:SolidPeso molecolare:1063.16TBTU
CAS:Formula:C11H16BF4N5OPurezza:≥ 99.0%Colore e forma:White to almost white powderPeso molecolare:321.08Antennapedia Peptide FAM-labeled
Antennapedia Peptide FAM-labeled, a fluorophore-tagged peptide, functions as a molecular probe in cancer research [1].Colore e forma:Odour SolidZ-Asp(OBzl)-OH
CAS:Z-Asp(OBzl)-OH (N-Cbz-L-Aspartic acid 4-benzyl ester) is an aspartic acid derivative.Formula:C19H19NO6Purezza:98.71%Colore e forma:SolidPeso molecolare:357.365(6)-CR110 [5-(and 6)-Carboxyrhodamine 110] *Mixed isomers*
5(6)-CR110 [5-(and 6)-Carboxyrhodamine 110] *Mixed isomers* is a Fluorescein for peptide and oligonucleotide labeling.Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81Sphistin Synthetic Peptide
Sphistin peptide (12-38, FITC-labeled N-terminus) is a potent antimicrobial truncated fragment.Formula:C159H250N50O37SPurezza:98%Colore e forma:SolidPeso molecolare:3486.06Orexin B, human TFA (205640-91-1 free base)
Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.
Formula:C123H212N44O35S·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3013.36RGD peptide (GRGDNP) (TFA) (114681-65-1 free base)
RGD peptide (GRGDNP) (TFA) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.Formula:C25H39F3N10O12Purezza:98%Colore e forma:SolidPeso molecolare:728.63FITC-β-Ala-β-Amyloid (25-35)
FITC-β-Ala-β-Amyloid (25-35) is a FITC-labeled fluorescent compound utilized in Alzheimer's disease research [1].Colore e forma:Odour SolidAllatostatin IV
CAS:Allatostatin IV, an insect octapeptide, regulates juvenile hormone synthesis.Formula:C45H68N12O12Purezza:98%Colore e forma:SolidPeso molecolare:969.09Margatoxin TFA
Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitorFormula:C178H286N52O50S7·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:4178.95 (free base)Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Formula:C172H263N43O52·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3879.27Z-VRPR-FMK (TFA)
Z-VRPR-FMK (TFA) is a tetrapeptide that selectively and irreversibly inhibits MALT1 in lymphoid tissue.Formula:C33H50F4N10O8Purezza:98%Colore e forma:SolidPeso molecolare:790.81Antennapedia Peptide
CAS:Antennapedia Peptide: 16-mer from Drosophila domain, induces cellular uptake.Formula:C104H168N34O20SPurezza:98%Colore e forma:SolidPeso molecolare:2246.8Biotin-Gastrin Releasing Peptide, human
Biotin-Gastrin Releasing Peptide, human, is a biotinylated derivative of gastrin-releasing peptide (GRP), a neuropeptide known for its growth-stimulatory and
Colore e forma:Odour SolidX-press Tag Peptide
X-press Tag: an N-terminal peptide with polyhistidine, T7 gene 10 Xpress epitope, and enterokinase site, detected by anti-Xpress antibodies.Formula:C41H59N9O20Purezza:98%Colore e forma:SolidPeso molecolare:997.96PKItide
CAS:PKItide demonstrates an inhibitory concentration 50 (IC50) of 0.2 μM against cAMP-dependent protein kinase (cAMP-PK) [1].Formula:C85H149N31O24Purezza:98%Colore e forma:SolidPeso molecolare:1989.29Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
Acetyl-PHF6 amide TFA is a tau derived hexapeptide.Formula:C40H64F3N9O11Purezza:98%Colore e forma:SolidPeso molecolare:903.99AD 01
CAS:FKBPL-based peptide increases CD44, hinders BCSC growth, impacts pluripotency, inhibits angiogenesis, and blocks tumor growth in models.Formula:C115H187N33O42Purezza:98%Colore e forma:SolidPeso molecolare:2703.94Pezadeftide
CAS:Pezadeftide, a potent antifungal peptide, readily penetrates fungal cells, eliciting an immediate mitochondrial response that leads to hyperpolarization of thePurezza:98%Colore e forma:SolidIRBP(668-687) (TFA) (1977546-93-2 free base)
IRBP(668-687) TFA, a segment of human IRBP, can cause uveitis.
Formula:C93H152F3N25O34Purezza:98%Colore e forma:SolidPeso molecolare:2221.34Acetyl tetrapeptide-9
CAS:Acetyl tetrapeptide-9 is important for the stimulation of basement membrane polysaccharide (lumican) and the synthesis of collagen I.Formula:C22H33N7O9Purezza:98%Colore e forma:SolidPeso molecolare:539.54Boc-DL-Phg-OH
CAS:Formula:C13H17NO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Light yellow powder to crystalPeso molecolare:251.28O-(6-Chlorobenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium Hexafluorophosphate
CAS:Formula:C11H15ClF6N5OPPurezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:413.69Ethyl 3-Piperidinecarboxylate
CAS:Formula:C8H15NO2Purezza:>98.0%(GC)(T)Colore e forma:Colorless to Almost colorless clear liquidPeso molecolare:157.21Boc-DL-Phe-OH
CAS:Formula:C14H19NO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Light yellow powder to crystalPeso molecolare:265.31Methyl N-Acetyl-L-tryptophanate
CAS:Formula:C14H16N2O3Purezza:>98.0%(HPLC)Colore e forma:White to Light yellow powder to crystalPeso molecolare:260.29N-Acetyl-S-benzyl-DL-cysteine
CAS:Formula:C12H15NO3SPurezza:>98.0%(T)Colore e forma:White to Almost white powder to crystalinePeso molecolare:253.32N-(tert-Butoxycarbonyl)-L-cyclopropylglycine
CAS:Formula:C10H17NO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:215.253-(3-Pyridyl)-L-alanine Dihydrochloride
CAS:Formula:C8H10N2O2·2HClPurezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:239.10
![[Glu1]-Fibrinopeptide B](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1864.webp&w=3840&q=75)
![[pSer2, pSer5, pSer7]-CTD](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1683.webp&w=3840&q=75)
