Peptidi
Sottocategorie di "Peptidi"
Trovati 29874 prodotti di "Peptidi"
Atrial Natriuretic Factor (1-28)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C127H203N45O39S3Peso molecolare:3,080.46 g/molCMVpp65 - 8 (RGDTPVLPHETRLLQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,732 g/molH-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGIEEFLR^-OH
Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLGYLEQLLR^-OH
Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH
Peptide Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVQIPLPEGINFVR^-OH
Peptide H-GVQIPLPEGINFVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPEGVPPLLVSQQAK^-OH
Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,740 g/molAc-HAIYPRH-OH
Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PKPPKPVSKMRMATPLLMQA-OH
Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNFYAWK^-OH
Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-GAGSLQPLALEGSLQKRG-OH
Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTPQAFSHFTFER^-OH
Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-IQKEIDRLNEVAKNLNESLI-OH
Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Cy3B]-LifeAct (Abp140 1-17)
[Cy3B]-LifeAct (Abp140 1-17) contains the 17amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. On application, lifeact can be used in the study of plant development and pathogen defence as filamentous actin within the plant actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements.The addition of the Cy-Dye fluorophore, Cy3B allows the location of the LifeAct (Abp140 1-17) to be detected. Cy3B is described as being conformationally locked meaning it is less likely to undergo photo-isomerization and one of its main applications is within DNA related studies.Colore e forma:PowderPeso molecolare:2,465.2 g/molH-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.IL 1 beta Human
IL-1 beta is a cytokine that plays an important role in the inflammatory response. IL-1 beta is produced by macrophages, monocytes, and fibroblasts in response to stimuli such as lipopolysaccharide (LPS), bacterial endotoxin, and other cytokines. It is also produced by keratinocytes and dendritic cells in response to bacterial products. IL-1 beta binds to the IL-1 receptor on the cell surface membrane, triggering a cascade of reactions inside the cell that lead to changes in gene expression and protein production. IL-1 beta can be used as an indicator of inflammation due to its release by activated lymphocytes, natural killer cells, and neutrophils during acute infections. The presence of this substance indicates that there has been tissue damage or some other form of cell injury.
Purezza:>98% By Sds-Page And Rp-Hplc.H-IWLDNVR^-OH
Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-97/aa385 - 399
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,724.1 g/molH-EIGELYLP^K-OH
Peptide H-EIGELYLP^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MeOSuc-Ala-Ala-Pro-Met-AMC
CAS:MeOSuc-Ala-Ala-Pro-Met-AMC is a substrate for the aminopeptidase. It has been shown to have minimal effects on intestinal cells and analyzed peptidases, proteolytic peptidases, and aminopeptidases. This compound is not pathogenic and can be used as a modulator of oncospheres and parasites.Formula:C31H41N5O9SPurezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:659.75 g/molLCBiot-EDIIRNIARHLAQVGDSMDR-OH
Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PHSRN-NH2
Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Hexynoic-CTTHWGFTLC-OH
Peptide 5Hexynoic-CTTHWGFTLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PrEST Antigen TAS2R39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:21 g/molH-SHFANL^K-OH
Peptide H-SHFANL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTFSNIK^-OH
Peptide H-VTFSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVLETFTVK^-OH
Peptide H-DVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMV IE-1 (213-225)
CMV pp65 (415-429) (HLA-B7) is a CEF (cytomegalovirus, Epstein-Barr virus, and influenza virus) control peptide that is derived from the Cytomegalovirus (CMV). CMV is capable of infecting a wide range of human cell types, where the body's primary immune response to CMV is innate, and relies on inflammatory cytokines and costimulatory molecules in order to control the spread of the virus. CMV pp65 (415-429) (HLA-B7) is defined as a CEF control peptide due to its antigenic properties. Clinically, these peptides are suitable epitopes for CD8+ T cells and can be used to stimulate the release of IFNg. HLA-B7 refers to the cell HLA type that this peptide acts on.Peso molecolare:1,516.8 g/molH-Glu-Glu-Leu-OH
CAS:H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential natureFormula:C16H27N3O8Purezza:Min. 95%Colore e forma:White Off-White PowderPeso molecolare:389.40 g/molFmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is a pharmacological research tool that is used to study protein interactions. It is also used as an inhibitor in the synthesis of peptides and has a high purity. This resin can be used for the production of antibodies, which are antibodies that specifically bind to a particular antigen. Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is an ion channel inhibitor that blocks voltage gated sodium channels, which are involved in pain transmission.Purezza:Min. 95%H-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molH-Asp(Lys-OH)-OH
CAS:H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).Formula:C10H19N3O5Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:261.28 g/molH-TA^VNALWGK^-OH
Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-S^LS^LSPGK^-OH
Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Angiotensin I (1-9)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H78N16O13Peso molecolare:1,183.35 g/molN-Formylmethionyl-leucyl-tyrosine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C21H31N3O6SPeso molecolare:453.6 g/molAc-WEDWVGWI-NH2
Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GITWK^-OH
Peptide H-GITWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-KFEEERARAKWDT-OH
Peptide Myr-KFEEERARAKWDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILSP^FLPLL^-OH
Peptide H-ILSP^FLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neurogranin (43-75) (Human, Monkey)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,984.34 g/molLCBiot-NLRKSGTLGHPGSL-OH
Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLQPFPQPELPY-OH
Peptide H-QLQPFPQPELPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C194H297N55O56SPeso molecolare:4,327.9 g/molAc-CLSHPYLYAQLDGPR-NH2
Peptide Ac-CLSHPYLYAQLDGPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 16 (YTPDSTPCHRGDNQL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/mol(Gly-Pro-Pro)7
Gly-Pro-Pro (Gly-Pro-Pro)7 is a peptide that has been shown to inhibit the activity of various proteases, including collagenase and elastase. It also inhibits the activity of matrix metalloproteinases, which are enzymes that degrade collagen and other extracellular matrix proteins. Gly-Pro-Pro (Gly-Pro-Pro)7 is therefore potentially useful for the treatment of diseases involving excessive degradation of connective tissue.
Formula:C84H121N21O22Purezza:Min. 95%Peso molecolare:1,777.03 g/molCMVpp65 - 76 (HFGLLCPKSIPGLSI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,582 g/molNangibotide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C54H82N14O22S2Peso molecolare:1,343.44 g/molFmoc-GRGDSPK-OH
Peptide Fmoc-GRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSEINPTTQMK^-OH
Peptide H-SVSEINPTTQMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GYG-OH
Peptide Ac-GYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GELNEHLGLLGPYIR^-OH
Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-MYWVRQAPGKGLEW-NH2
Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myelin PLP (178-191)
Myelin PLP (178-191) is a peptide that is immunogenic. It is useful for the study of myelin protein and its role in the human body. It can be used for various purposes, such as studying the effects of myelin protein on the immune system or how it is involved in neural transmission.Formula:C70H105N18O22SPurezza:Min. 95%Peso molecolare:1,582.79 g/molH-VVAAVGDAVK^-OH
Peptide H-VVAAVGDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLAVYQAGAR^-OH
Peptide H-CLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^YIHPFHL-OH
Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Temporin L
Temporin L is a highly potent anti-microbial peptide (AMP) active against both Gram-positive and Gram-negative bacteria. Temporins are a large family of short, linear, AMPs produced in the skin of frogs belonging to Rana species, but are also found in wasp venom. Temporin L was originally isolated from the frog Rana temporaria and has the highest anti-microbial potency among tested temporins, especially against Gram-negative bacteria.Temporin L increases bacterial inner membrane permeability in a dose-dependent manner without destroying cell integrity. At low peptide concentrations, the inner membrane becomes permeable to small molecules but this does not kill the bacteria. At high concentrations, larger molecules, but not DNA, leak out, resulting in cell death. Temporin L has a different mode of action to many AMPs as it does not lyse the cells but instead forms ghost-like bacteria shells.Colore e forma:PowderPeso molecolare:1,639 g/molBiot-ERGVT-OH
Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIPGGIYDADLNDEWVQR^-OH
Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-Asp-OH
CAS:H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.Formula:C7H12N2O5Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:204.18 g/molH-GSSDVDQLGK^-OH
Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STVHEILCKLSLEG-NH2
Peptide H-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
rec FGF acidic (human)
CAS:Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:Min. 95%H-FLNQTDETL^-OH
Peptide H-FLNQTDETL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFYFNKPTGYGSSSR^-OH
Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Adrenomedullin (22-52)
Adrenomedullin (ADM), is a free circulating peptide of the amylin/calcitonin gene-related peptide (CGRP) super-family. It is widely expressed in virtually all human tissues and is involved in regulation of endothelial barrier function- vascular tone- immunoregulation- cellular proliferation and apoptosis. ADM is implicated in the pathophysiology of several diseased states including: sepsis- heart failure- inflammatory bowel disease- diabetes- eye pathologies and many cancers. ADM levels are often increased during these diseased states often correlating with disease severity and mortality. ADM is therefore of interest as a target for these diseases. ADM also displays potent antimicrobial action against Gram-positive and Gram-negative bacteria.The 52 amino acid ADM is produced by multiple cleavage steps from the original 85 amino acid long preprohormone (prepro-ADM). ADM exerts its effects by ligation of receptor complexes consisting of the calcitonin receptor-like receptor (CRLR) combined with a specific receptor activity-modifying protein (RAMP). Interaction of ADM with its receptor occurs through its C-terminal moiety.
Peso molecolare:3,573.9 g/molHXB2 gag NO-67
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,803.2 g/molH-SANILLDEAF^TAK-OH
Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-His-OH acetate
CAS:H-Ser-His-OH acetate salt is an amide that has been shown to have a neutral pH and to be soluble in organic solvents such as chloroform. It has a biological function of being a serine protease inhibitor. H-Ser-His-OH acetate salt binds to the amino acid histidine and inhibits the activity of serine proteases. This product has been used in fluorescence techniques, immunofluorescence analyses, and molecular biology.Formula:C9H14N4O4·xC2H4O2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:242.24 g/molSARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C97H144N22O30Peso molecolare:2,098.43 g/molH-TKQTAR^^-OH
Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KPVSLSYRCPCR^FFE-OH
Peptide H-KPVSLSYRCPCR^FFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HBV polymerase (455-463)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C46H79N15O12Peso molecolare:1,034.24 g/molH-LYL^VCGERGF-OH
Peptide H-LYL^VCGERGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IL 6 Human
IL-6 Human is a recombinant peptide, which belongs to the class of activator. It is an inhibitor that binds to the IL-6 receptor and inhibits IL-6 binding. IL-6 Human has been shown to inhibit protein interactions, such as cytokine receptors and ligands. IL-6 Human may also inhibit ion channels. This product is a research tool for use in life science and cell biology experiments.
Purezza:>97% By Sds-Page & Rp-Hplc.Fluor-VPMLK-OH
Peptide Fluor-VPMLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQPTTPSEPTAIK^-OH
Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PEK-NH2
Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.D-Pen(p-Me-Bzl)
As a metabolite of penicillin and a di-methly analog of cysteine, D-Penicillamine (D-Pen) has properties as a heavy metal chelator. In particular, D-Pen forms complexes with thiol groups of copper ions and so can help regulate conditions such as Wilson’s disease, contributing to the renal excretion of copper. Studies have suggested that D-Pen could be used in the treatment of Alzheimer’s disease due to a reduced activity of copper and zinc superoxide dismutases in the blood of Alzheimer’s disease patients. It can further be used to treat copper and lead poisoning cases. Although D-Pen is clinically relevant, it is important to distinguish it from its enantiomer L-Pen which has been found to be toxic and can result in neuritis and marrow damage.Formula:C13H19NO2SPurezza:Min. 95%Peso molecolare:253.2 g/molBQ-788 Sodium Salt
CAS:BQ-788 is a sodium salt that has high resistance to corrosion. It is effective in wastewater treatment, as it can be used as a coagulant and flocculant. BQ-788 is an electrochemical impedance spectroscopy (EIS) active ingredient that has been shown to have good thermodynamic data. This chemical substance also displays optimum concentration at 6 mM in sulfuric acid and crystalline cellulose, with a solubility of 2.5% at room temperature. The EIS measurements were performed on the locomotor activity of rats with metabolic disorders, which led to the conclusion that BQ-788 is an important factor for locomotor activity through its effects on the central nervous system and peripheral nervous system.Formula:C34H50N5O7NaPurezza:Min. 95%Peso molecolare:663.8 g/molHCMV IE1 81-89 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFYLAGGVPR^-OH
Peptide H-AFYLAGGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATEII^EPSK-OH
Peptide H-ATEII^EPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Thr(tBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Thr(tBu)-2-ClTrt-Resin is an amine resin that is used as a building block for the synthesis of peptides. It is used in conjunction with other resins and chemicals to produce a wide variety of peptides. The resin contains 1% DVB, which improves the solubility and stability of the resin. This product can be used in a variety of applications, including peptide synthesis, protein sequencing, and antibody production.Purezza:Min. 95%HXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,765.1 g/molH-K^AFSPEVIPMF-OH
Peptide H-K^AFSPEVIPMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Exendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C184H282N50O60SPeso molecolare:4,186.7 g/molAc-CSDPVATSSTLGLQENMRTS-OH
Peptide Ac-CSDPVATSSTLGLQENMRTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GP120 - W61D - 120
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,784 g/molH-VDSALYLGSR^-OH
Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLNDILSR^L-OH
Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Larazotide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C32H55N9O10Peso molecolare:725.83 g/molH-IILEALR^-OH
Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGVAPDHPEVK^-OH
Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILDFGLAR^-OH
Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HHHHHHC-OH
Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-GIGTIISSPYR-OH
Peptide H2N-GIGTIISSPYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATVVYQ^GER-OH
Peptide H-ATVVYQ^GER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPNAGQMQPVK^-OH
Peptide H-IPNAGQMQPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Annexin A1(1-25)(dephosphorylated)(human)ammonium salt
CAS:Annexin A1 is a phospholipid-binding protein that is involved in the regulation of inflammation. It is often found in atherosclerotic lesions and has been shown to be an anti-inflammatory cytokine. Annexin A1 (dephosphorylated) does not inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase, and so it may have therapeutic potential for treatment of autoimmune diseases such as Crohn's disease or bowel disease. Annexin A1 also has anti-inflammatory properties, which may be due to its ability to inhibit the production of proinflammatory cytokines such as IL-6 and TNF-α by inhibiting the activation of NFκB.Formula:C141H210N32O44S·NH4Purezza:Min. 97 Area-%Colore e forma:White PowderPeso molecolare:3,107.47 g/molZ-Gly-Met-OH
CAS:Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.Formula:C15H20N2O5SPurezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:340.4 g/molLCBiot-YAPP-OH
Peptide LCBiot-YAPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGTDDHTLIR^-OH
Peptide H-GAGTDDHTLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Glu(Tyr-OH)-OH
CAS:H-Glu(Tyr-OH)-OH is an amino acid analogue that has been shown to have natriuretic effects. It also has anti-inflammatory and analgesic properties, which are likely due to its ability to inhibit the bacterial enzyme arginase. H-Glu(Tyr-OH)-OH is a part of a class of compounds called oximes, which are used in the treatment of poisoning by organophosphates, pyrethroid insecticides, and carbamates. The compound is synthesized by treating L-glutamic acid with hydrogen peroxide and tyrosine in acidic conditions. H-Glu(Tyr-OH)-OH has also been found to have a protective effect on alcohol induced damage in rats. This may be due to its ability to increase the synthesis of dopamine, which is involved in the regulation of blood pressure and water balance.Formula:C14H18N2O6Purezza:Min. 95%Colore e forma:PowderPeso molecolare:310.3 g/molLCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2
Peptide LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSEIQLMHNLGK^HLNSMERVEWLRKKLQDVHN-OH
H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TYFAVLM-NH2
Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Ile-Glu-Pro-Asp-AMC
CAS:AMC conjugated molecule targeting caspase-8 and granzyme B
Formula:C32H41N5O11Purezza:Min. 97 Area-%Colore e forma:PowderPeso molecolare:671.7 g/molLCBiot-YGGFLRRIRPKLK-OH
Peptide LCBiot-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVDVEEQQLEESGPHDLTETSYLPR^-OH
Peptide H-VVDVEEQQLEESGPHDLTETSYLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFDNAMLR^-OH
Peptide H-LFDNAMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVMEYLPSGCLR^-OH
Peptide H-LVMEYLPSGCLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFDQIDNAPEEK^-OH
Peptide H-AFDQIDNAPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pal-KVK-OH
Peptide Pal-KVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVY^FCHLDIIW^-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C109H163N25O32S5Peso molecolare:2,495.97 g/molH-AASLDGFYNGR^-OH
Peptide H-AASLDGFYNGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RFGRFLRKILRFLKK-NH2
Peptide Ac-RFGRFLRKILRFLKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Defensin-1 (human) HNP-1
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C150H222N44O38S6Peso molecolare:3,442.1 g/molH-DALSSVQESQVAQQ^AR-OH
Peptide H-DALSSVQESQVAQQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB
For preparation of acids, alcohols, thiols, or amines
Purezza:Min. 95%rec Oncostatin M (human)
CAS:Please enquire for more information about rec Oncostatin M (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%H-VITKPFTK^-OH
Peptide H-VITKPFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block for peptide synthesis. It is a resin that contains amines and thiols. H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB also has the tools for peptide synthesis, such as alcohols and resins.Purezza:Min. 95%H-YWGVASFLQK^-OH
Peptide H-YWGVASFLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FA-Gly-Leu-Ala-OH TFA
CAS:FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.Formula:C18H25N3O6•TFAPurezza:Min. 95%Colore e forma:PowderPeso molecolare:493.43 g/molH-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EITFHGAK^-OH
Peptide H-EITFHGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALPQYLK^-OH
Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C49H74N10O11Peso molecolare:979.18 g/molH-PQNLLLDPDTAVLK^-OH
Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLGAFSDGLAHLDNLK^^-OH
Peptide H-VLGAFSDGLAHLDNLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-WAKW-NH2
Peptide Ac-WAKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MOCAc-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH₂
CAS:MOCAc-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg is a peptide that is used as an activator and inhibitor of ion channels. This peptide has been shown to be a potent inhibitor of the voltage dependent Na+ channel, which is responsible for the depolarization of nerve and muscle cells. MOCAc has also been shown to bind with high affinity to the NMDAR receptor in a competitive manner. The binding of this peptide to the NMDAR receptor prevents glutamate from binding, which leads to inhibition of downstream signaling pathways such as NMDA receptor activation and intracellular calcium release.Formula:C61H82N16O18Purezza:Min. 95%Peso molecolare:1,327.4 g/molFor-MAIVGTIIKIIKAIIDIFAK-OH
Peptide For-MAIVGTIIKIIKAIIDIFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KRFKQDGGWSHWSPWSSC-NH2
Peptide Ac-KRFKQDGGWSHWSPWSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bz-Arg-His-D-Asp-CH2Cl trifluoroacetate
CAS:Bz-Arg-His-D-Asp-CH2Cl is a research tool that can be used as an activator or ligand in cell biology and pharmacology. This product is also a receptor, which is a protein that binds to one or more specific substances (ligands) and triggers a change in the activity of cells. Receptors are often located on the surface of cells, such as those in the brain, heart and muscles. Bz-Arg-His-D-Asp-CH2Cl can be used to inhibit ion channels and has been shown to block receptors for acetylcholine, histamine and serotonin. Bz-Arg-His-D-Asp-CH2Cl also blocks calcium channels and potassium channels. This product has been shown to inhibit the activity of phospholipase A2, which helps break down fats into fatty acids. It also inhibits the activity of aminopeptidases, which breaks down proteins intoFormula:C24H31ClN8O6•(C2HF3O2)xPurezza:Min. 95%Peso molecolare:563.01 g/molH-ISIDVNNNDIK^-OH
Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Delicious peptide (bovine) trifluoroacetate
CAS:Delicious peptide (bovine) trifluoroacetate is a polymerase chain reaction probe that is complementary to the 3' end of the human insulin gene. When used in a polymerase chain reaction, it amplifies the DNA sequences at the 3' end of the gene. The product of this amplification has been shown to inhibit genetic disorders such as metabolic disorders, iron homeostasis, and leukemia. This agent also inhibits acidic fibroblast proliferation and pluripotent cells. This drug has been shown to have a molecular docking analysis with pharmacological agents and may be helpful in treatments for various diseases.Formula:C34H57N9O16•(C2HF3O2)xPurezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:847.87 g/molBoc-Val-Leu-Lys-AMC
CAS:Boc-Val-Leu-Lys-AMC is a research tool that has been shown to activate ion channels and increase the permeability of cell membranes. This compound also binds to receptors on cells, which may be due to its ability to bind with antibodies. Boc-Val-Leu-Lys-AMC has been used as an inhibitor in protein interactions and pharmacology studies, as well as for the study of ion channels in cell biology.Formula:C32H49N5O7Purezza:Min. 95%Peso molecolare:615.76 g/molHepcidin-25 (human) trifluoroacetate salt
CAS:Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C113H170N34O31S9·C2HF3O2Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:2,903.38 g/molH-YYQQLK^-OH
Peptide H-YYQQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQVYSR^-OH
Peptide H-IQVYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSLFFFPLPLLIK^-OH
Peptide H-GSLFFFPLPLLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLANVSTVLTSK^-OH
Peptide H-FLANVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H2NCO-HAEGTFTSDVSSYLEGQ-NH2
Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH
Peptide H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Gln-Gly-Arg-AMC·HCl
CAS:Boc-Gln-Gly-Arg-AMC·HCl is a reagent that is used as a reaction component in the synthesis of peptides, antibiotics, and other complex compounds. Boc-Gln-Gly-Arg-AMC·HCl is also a useful scaffold for the synthesis of new fine chemicals. This chemical has a CAS number of 133448-21-2, and is classified as a speciality chemical and versatile building block. It can be used to synthesize various fine chemicals with high purity and quality.Formula:C28H40N8O8·HClPurezza:Min. 95%Colore e forma:PowderPeso molecolare:653.13 g/molH-GFYPSDIAVEWESNGQPENNYK^-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.m-dPEG®8-Azide (Azido-m-dPEG®8)
CAS:m-dPEG®8-Azide (Azido-m-dPEG®8) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Azide (Azido-m-dPEG®8) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purezza:Min. 95%Peso molecolare:409.48 g/molLeupeptin hemisulfate anhydrous (vial)
CAS:Leupeptin is an ion channel blocker that belongs to the group of protease inhibitors. It blocks the passage of ions across cell membranes by binding to the active site of a variety of enzymes in the membrane. Leupeptin is used as a research tool for studying protein interactions, and can be used for antibody production. Leupeptin is also useful in cell biology studies, because it inhibits the activation of many proteins involved in signal transduction and cell division.Formula:C20H38N6O4Purezza:Min. 95%Peso molecolare:426.55 g/molH-GAVVGVGDESR^-OH
Peptide H-GAVVGVGDESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGSEAYNQQLSEK^-OH
Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Leu-Gly-OH
CAS:Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Formula:C10H19N3O4Peso molecolare:245.28 g/molAc-QQRFEWEFEQQ-NH2
Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C72H98O22N20Peso molecolare:1,595.7 g/molH-Leu-Tyr-OH
CAS:H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Formula:C15H22N2O4Peso molecolare:294.35 g/molSIVmac239 - 106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,688 g/molH-GDVTAQIALQPALK^-OH
Peptide H-GDVTAQIALQPALK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp(Ala-OH)-OH
CAS:H-Asp(Ala-OH)-OH is an amino acid that has been found to be selectively active in the cerebral cortex. It has a high affinity for the cerebral cortex, with a Kd of 1.5 nM and a brain tissue concentration of 3.3 µg/g. H-Asp(Ala-OH)-OH has been shown to have neuroprotective effects against hypoxia, glutamate toxicity, and oxygen deprivation. This compound reverses the effects of oxidative stress in cultured cells and can also stimulate protein synthesis in cultured cells. The mechanism by which it works is not yet known but may involve inhibition of cysteine uptake into the cell or stimulation of protein synthesis by increasing intracellular levels of cAMP.Formula:C7H12N2O5Purezza:Min. 95 Area-%Colore e forma:White PowderPeso molecolare:204.18 g/molH-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLSPTVWLSV^-OH
Peptide H-GLSPTVWLSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB
CAS:Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB is a reaction solution that is used in biological studies. It reacts with human serum to form a bicyclic heterocycle. The hydrogen fluoride in the reaction solution reacts with the trifluoroacetic acid to form an intermediate, which then reacts with the chloromethylated polystyrene resin to form the bicyclic heterocycle. The redox potentials of this reaction are measured and can be used as a probe for determining the chemical stability of this product. This product has been shown to have fluorescence properties and can be used as a probe for detecting DNA and RNA samples in vitro.Purezza:Min. 95%H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^LITGRLQSL-OH
Peptide H-R^LITGRLQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFLHSGTAK^-OH
Peptide H-LGFLHSGTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Phe-AMC
CAS:H-Gly-Phe-AMC is a synthetic substrate that is used in homogeneous enzyme assays. This product has been shown to have inhibitory properties against proteolytic enzymes such as peptidases, which are enzymes that break down proteins. H-Gly-Phe-AMC is also reactive with collagen and has been shown to be useful in the study of biochemical properties of peptide hormones.Formula:C21H21N3O4Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:379.41 g/molTau Peptide (45-73)
Amino acids 45-73, derived from the exon 2/insert 1 domain, of tubulin-associated unit (tau). Tau is a phosphoprotein protein involved in microtubule (MT) assembly and stability as well as brain development. Tau is phosphorylated at multiple sites by several protein kinases, including cyclic-AMP-dependent protein kinases and casein kinase type-1. Tau phosphorylation causes tau to change shape negatively regulating its ability to stimulate MT assembly. Tau is also glycosylated, and O-glycosylation may have a role in its subcellular localisation and degradation.Malfunctioning tau protein contributes to the structural core of the paired helical filaments (PHFs), which make up neurofibrillary tangles (NFTs). NFTs are often observed in neurodegenerative disorders, such as Alzheimer disease and other tauopathies. Tau is expressed from a single gene and is alternatively spliced to yield six different isoforms in the adult central nervous system (CNS).
Peso molecolare:2,976.3 g/molBoc-D-Ala-OH
CAS:Boc-D-Ala-OH is a chiral amino acid that can be used in the synthesis of peptides. Boc-D-Ala-OH is a building block for the synthesis of amino acids, and it can also be used as a ligand to form metal complexes. This product has been shown to be effective in reducing optical activity through chemoenzymatic reduction processes. Boc-D-Ala-OH has also been shown to be hydrolyzed by various enzymes, including alcohols and acrylates.
Formula:C8H15NO4Purezza:Min. 95%Peso molecolare:189.21 g/molH-AAGIGILTV^-OH
Peptide H-AAGIGILTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DEVDAFC-OH
Peptide Ac-DEVDAFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSVSDYVNYDIIVR^-OH
Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CEPLEKQHEKERKQEEGES
Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-VAELEHGSSAYSPPDAFK^-OH
Peptide H-VAELEHGSSAYSPPDAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHVGDEDFVHLR^-OH
Peptide H-VHVGDEDFVHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAPQLSTEELVSLGEK^-OH
Peptide H-IAPQLSTEELVSLGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELVSEFSR^-OH
Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TNF α Human
CAS:TNF-α is a cytokine that has been shown to be a potent inducer of tumor necrosis. It also promotes the activation of macrophages, neutrophils, and endothelial cells. TNF-α is produced by many different cell types, but most notably by activated macrophages and lymphocytes. TNF-α is secreted from these cells in response to stimulation with lipopolysaccharide or other agents such as LPS, IL1β, or CD40 ligand. The protein encoded by this gene is an important cytokine for the immune system.
Purezza:Min. 95%H-GNDVAFHFNPR^-OH
Peptide H-GNDVAFHFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVINGNPITIFQER^-OH
Peptide H-LVINGNPITIFQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-SIINFEKLGSGHWDFAWPW-OH
Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aoa-DYKDDDDK-OH
Peptide Aoa-DYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-3 (1-6) amide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C29H46N10O7Peso molecolare:646.75 g/molH-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDIER^-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
![[Cy3B]-LifeAct (Abp140 1-17)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130929.webp&w=3840&q=75)
