Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPASPETHL^DMLR^-OH
Peptide H-LPASPETHL^DMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AHIFDLAINK^-OH
Peptide H-AHIFDLAINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAY-NH2
Peptide Ac-CAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2
Peptide H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Toolp53 Protein, human, recombinant
The p53 protein is a transcription factor that regulates the cell cycle and suppresses tumor development. It is a type of tumor suppressor protein that helps prevent cells from becoming cancerous. The p53 protein is found in every human cell and has been shown to play an important role in apoptosis, or programmed cell death. The recombinant p53 protein can be used as an inhibitor for ion channels and as a research tool for studying protein interactions.Purezza:Purified By Proprietary Chromatographic TechniquesLCMV gp 276-286 (H-2 Db)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C46H70N12O17SPeso molecolare:1,095.18 g/molSIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,636.9 g/molH-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB is an alcohol resin that is used as a building block in peptide synthesis. It can be used with other alcohol resins, amines and thiols to synthesize peptides. The resin is also compatible with a variety of functional groups including carboxylic acids, amino acids and thiols. H-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB has been shown to be effective in the synthesis of peptides containing Arg, Lys, Trp and Tyr. This resin is soluble in organic solvents such as dichloromethane and ether.Purezza:Min. 95%Atrial natriuretic factor (1-28) trifluoroacetate
CAS:Please enquire for more information about Atrial natriuretic factor (1-28) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C127H203N45O39S3•C2HF3O2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:3,194.47 g/molGelsolin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DRVYI^HPFHL-OH
Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FA-Phe-Gly-Gly-OH
CAS:FA-Phe-Gly-Gly-OH is a peptide with angiotensin II inhibitory properties. It has been shown that FA-Phe-Gly-Gly-OH inhibits the enzyme activity of angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II, which causes blood vessel constriction. The inhibitory effects of FA-Phe-Gly-Gly-OH on ACE are reversible and competitive, which is different from other ACE inhibitors that are irreversible and noncompetitive. This peptide also has antioxidative properties, due to its ability to scavenge reactive oxygen species (ROS). This peptide can be hydrolysed by esterases or proteases in vitro or in vivo.
Formula:C20H21N3O6Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:399.4 g/molExendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C184H282N50O60SPeso molecolare:4,186.7 g/molBiot-RRRDDDSDDD-NH2
Peptide Biot-RRRDDDSDDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-Trp-OH
CAS:H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.
Formula:C20H21N3O3Purezza:Min. 95%Colore e forma:PowderPeso molecolare:351.4 g/molH-ATYPLPIRC-NH2
Peptide H-ATYPLPIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVMDDFAAFVEK^-OH
Peptide H-AVMDDFAAFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CREB327 (113-126)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C76H131N25O21Peso molecolare:1,731.05 g/molH-HQGLPQEVLNENLLR^-OH
Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molH-DGLDAASYYAPVR^-OH
Peptide H-DGLDAASYYAPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 53
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molAc-CGASKPKKKAKGLFM-OH
Peptide Ac-CGASKPKKKAKGLFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CLEAR-Base Resin (HCl) (100-200 mesh)
CLEAR-Base Resin (HCl) is a high-purity resin that has been used in the study of protein interactions, such as receptor and ligand binding. CLEAR-Base Resin (HCl) is also an inhibitor that can be used to block ion channels.Purezza:Min. 95%Biot-KKKSPGEYVNIEFG-NH2
Peptide Biot-KKKSPGEYVNIEFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLKMPHWPHLLP-NH2
Peptide H-SLKMPHWPHLLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVINEAWFPEDQR^-OH
Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 135 (PKRRRHRQDALPGPC)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,787.1 g/molEnv 57-71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-Arg-AMC hydrochloride
CAS:H-Arg-AMC hydrochloride is a denaturing agent that is used to prevent the proteolytic degradation of proteins in muscle and other tissues. It has been shown to inhibit the activity of lipase, myofibrillar, and endoplasmic enzymes. H-Arg-AMC hydrochloride also has cancer preventive effects by inhibiting the growth of tumor cells. H-Arg-AMC hydrochloride has been shown to have high values in notochord markers, supplementing cytosolic markers, and endogenous markers.Formula:C16H21N5O3·xHClPurezza:Min. 95%Colore e forma:White PowderPeso molecolare:331.37 g/molH-SAFPTTINF^-OH
Peptide H-SAFPTTINF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ANISH-pNA
Peptide Ac-ANISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Glucagon , human, recombinant
Glucagon, human recombinant is a protein that is used to treat low blood sugar levels in people with diabetes. It is a hormone that triggers the release of glucose from the liver and other stored sources of energy. Glucagon, human recombinant can be reconstituted with sterile water for injection and then freeze-dried. This product is calibrated to contain 1 mg of glucagon per milliliter (1 mg/mL) with an n-terminal amino acid sequence that has been determined by Edman degradation to be methionine, valine, threonine, alanine, glutamic acid, proline, lysine and serine. Glucagon, human recombinant is prepared in a chromatographic purification process that utilizes dna replication and biochemical assays for quality control.br> Glucagon, human recombinant is used to treat low blood sugar levels in people with diabetes. It should not be used to treat type 1Purezza:>98% By Sds-Page And Rp-Hplc AnalysisH-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is used to immobilize amino acids, thiols, and other building blocks in order to synthesize peptides. This resin can be used for a variety of applications, including the synthesis of small organic molecules, oligonucleotides, and polysaccharides. H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with amines and thiols.
Purezza:Min. 95%Abz-EPFWEDQ-EDDnp
Peptide Abz-EPFWEDQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PKYVKQNTLKLAT-NH2
Peptide Ac-PKYVKQNTLKLAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLAVYQAGAR^-OH
Peptide H-CLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAFGEATLYR^-OH
Peptide H-GAFGEATLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CHHHHHH-OH PAB-402-60F
Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Z-Gly-Gly-Arg-AMC·HCl
CAS:Z-Gly-Gly-Arg-AMC·HCl is a proteolytic enzyme that cleaves proteins at the carboxyl side of the amino acid arginine. It has been shown to have potential as a drug target and has been found to be active against carcinoma cell lines, but not normal cells. Z-Gly-Gly-Arg-AMC·HCl is activated by light and can be inhibited by natural compounds such as 2-aminoethoxydiphenyl borate. In addition, it specifically cleaves proteins at the carboxyl side of arginine residues, which makes it useful for studying protein degradation mechanisms in living cells and tissues.Formula:C28H33N7O7·HClPurezza:Min. 98%Colore e forma:White PowderPeso molecolare:616.07 g/molH-MVLQNSGKFRAESRGDC-NH2
Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SIINFEKL-OH
Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
