Peptidi

<p>H-Met-Gln-OH TFA salt is a recombinant human metalloproteinase that has been shown to activate polymorphonuclear and mononuclear cells. H-Met-Gln-OH TFA salt enhances the production of reactive oxygen species and induces the release of proinflammatory cytokines such as tumor necrosis factor alpha, interleukin 1, and interleukin 6. This protein also cleaves sulfoxide bonds in proteins, which may be due to its ability to catalyze the oxidation of sulfhydryl groups in proteins. H-Met-Gln-OH TFA salt has been shown to be effective in enhancing red blood cell production, which may be due to its ability to cleave hemoglobin S bonds in erythrocytes.</p>

<p>Please enquire for more information about Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mycosubtilin is a potent antifungal lipopeptide, which is a secondary metabolite produced by the bacterium Bacillus subtilis. It is characterized by its ability to disrupt fungal cell membranes, leading to cell lysis and eventual death of the fungus. This mode of action is attributed to its amphiphilic structure, which allows it to integrate into the lipid bilayers of fungal cells, compromising the integrity of the membrane and altering its permeability.Mycosubtilin finds applications in various scientific and agricultural fields due to its efficacy against a broad spectrum of fungal pathogens. It is particularly useful in plant disease management, where it plays a role in biocontrol strategies against phytopathogenic fungi. Additionally, its antifungal properties make it a subject of interest in pharmaceutical research, where it is investigated for potential therapeutic applications in combating fungal infections. Researchers also explore Mycosubtilin as a model compound to understand lipopeptide interactions with membranes, contributing to the broader knowledge of antimicrobial agents.</p>

<p>Lysyllysyllysine is a cationic moiety. It may be used in the construction of gene delivery vectors and DNA nanoparticles.</p>

<p>Carnostatine (SAN9812), a potent CN1 inhibitor with 11 nM K i, may boost renal carnosine to treat DN.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>Proctolin modulates interneuronal and neuromuscular synaptic transmission in a wide variety of arthropods. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>A peptide hormone that plays a role in maintaining glucose homeostasis This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>

<p>SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.</p>

<p>Pam2CSK4 TFA (PUL-042 TFA) is a potent dual agonist of TLR2 and TLR6, a peptide that mimics bacterial lipoproteins.Pam2CSK4 TFA promotes platelet aggregation, and can be used to study the effects of lipoproteins on the periodontium.</p>

<p>CBD3063 is a CRMP2-based peptidomimetic small molecule that can regulate Cav 2.2 and can be used to study neurological diseases.</p>

<p>OVA Peptide (323-339) is an Ovalbumin epitope crucial for hypersensitivity in BALB/c mice.</p>

<p>PalMitoyl Tripeptide-1 hydrochloride (PalMitoyl Tripeptide-1 hydrochloride (147732-56-7 Free base)) has effects on the synthesis of collagen, fibronectin and hyaluronic acid in human skin fibroblasts, and can be used in the preparation of anti-aging cosmetics.</p>

<p>Elamipretide acetate (MTP 131), a small tetrapeptide, targets mitochondria to reduce toxic species and stabilize cardiolipin.</p>

<p>Darobactin is an antibiotic effective against critical Gram-negative pathogens, demonstrating activity both in vitro and in animal infection models [1].</p>

<p>PD-1/PD-L1 binder, Kd 0.51 μM; blocks interaction in flow cytometry at 1 mg/mL; inhibits tumors, extends mouse survival.</p>

<p>Tripeptide-41 (CG-Lipoxyn) is a bioactive peptide known for its ability to reduce fat accumulation.</p>

<p>Elamipretide (SS-31, MTP-131, Bendavia) is a mitochondria-focused peptide that curbs toxic ROS and stabilizes cardiolipin.</p>

<p>MTP 131 (acetate) is a small mitochondrially-targeted tetrapeptide.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>SK channel blocker</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SSLLDVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>