Peptidi
Sottocategorie di "Peptidi"
Trovati 29608 prodotti di "Peptidi"
H-FALLGDFFR^-OH
Peptide H-FALLGDFFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGRGKGGKGLGKGGAKRHRKVLRD-NH2
Peptide H-SGRGKGGKGLGKGGAKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLQHLIGL^-OH
Peptide H-SLLQHLIGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLEAELL^VLR^-OH
Peptide H-VLEAELL^VLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPEEK^-OH
Peptide H-VHLTPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Diethylcyanomethylphosphonate
CAS:Diethylcyanomethylphosphonate is a hydrochloric acid salt of diethylcyanomethylphosphonic acid. It is used in the asymmetric synthesis of many organic molecules, including pharmaceuticals, and has been shown to have antiviral properties. Diethylcyanomethylphosphonate binds to the receptor on the surface of cells and inhibits their growth. This may be due to its ability to block the binding of sodium ions to cell receptors. The drug also prevents hydroxyl group metabolism and has been shown to be active against infectious diseases such as HIV and malaria.
Formula:C6H12NO3PPurezza:Min. 95%Colore e forma:Colorless Clear LiquidPeso molecolare:177.14 g/molH-PVSKMRMATPLLMQA-OH
Peptide H-PVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C72H12N20O19S3Peso molecolare:1,674.1 g/molCMVpp65 - 91 (PQYSEHPTFTSQYRI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,854 g/molH-APYTFGQGTK^-OH
Peptide H-APYTFGQGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TNL-NH2
Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C99H154N24O27Peso molecolare:2,112.55 g/molCMVpp65 - 93 (FTSQYRIQGKLEYRH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,927.2 g/molAc-TYFAVLM-NH2
Peptide Ac-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE
Peptide CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CR-NH2
Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VISPSEDR^-OH
Peptide H-VISPSEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Leu-Val-Ser-Arg-AMC
Ac-Leu-Val-Ser-Arg-MCA is a peptide that has been identified as a potential MALT1 substrate. It is a small, cationic peptide with a molecular weight of 1,261. Ac-Leu-Val-Ser-Arg-MCA binds to the active site of MALT1 and inhibits its activity by binding to the zinc atom in the enzyme's active site. Ac-Leu-Val-Ser-Arg-MCA also prevents bacterial adhesion to epithelial cells and decreases inflammatory cytokines such as IL1β and TNFα.
Formula:C32H48N8O8Purezza:Min. 95%Peso molecolare:672.79 g/molH-IVKWDRDM^-OH
Peptide H-IVKWDRDM^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQDGDLTLYQSNTILR^-OH
Peptide H-FQDGDLTLYQSNTILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SRVEI-NH2
Peptide H-SRVEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Gastrin I, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C97H125N20O31SPeso molecolare:2,098.22 g/molH-FPETVLAR^-OH
Peptide H-FPETVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGFEDGSVLK^-OH
Peptide H-LGFEDGSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NDPTQQIPK^-OH
Peptide H-NDPTQQIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SLC38A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1754Purezza:Min. 95%H2N-Gln-Asp-Gly-Asn-Glu-Glu-Met-Gly-Gly-Ile-Thr-Gl
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C124H204N32O46S2Peso molecolare:2,943.26 g/mol5Fam-GPGPGPGPGPGPGPGPGPGP-OH
Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PGP 9.5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGP 9.5 antibody, catalog no. 20R-PG011Purezza:Min. 95%SLC12A8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A8 antibody, catalog no. 70R-6803Ac-CISQAIPKKKKVLE-OH
Peptide Ac-CISQAIPKKKKVLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFIAWLVK^-OH
Peptide H-EFIAWLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTDEYQLYEDIGK^-OH
Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Abca7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Abca7 antibody, catalog no. 70R-8571Purezza:Min. 95%H-KHNLGHGHKHERDQGHGHQR-NTBiot
Peptide H-KHNLGHGHKHERDQGHGHQR-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Antigen Peptide NCAP (AFFGMSRIGMEVTPSGTW)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C89H132N22O25S2Peso molecolare:1,974.37 g/molH-VAAEDWK^-OH
Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTFEGDLK^-OH
Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[5-FAM]-IFN-γ receptor (pTyr) peptide
Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &γ- (IFN&γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&γ- is secreted by immune cells and signals through the IFN&γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tagPeso molecolare:1,364.5 g/molH-ALPMHIR^-OH
Peptide H-ALPMHIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LMKNMDPLNDNV-NH2
Peptide Ac-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSFELFADK^-OH
Peptide H-VSFELFADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C80H138N26O24S2Peso molecolare:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,776.1 g/mol(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C196H299N53O55SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:4,309.86 g/molSuc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C32H40N6O9Peso molecolare:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-RWKFGGFKWR-OH
Peptide Myr-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[5-FAM]-IFN-γ receptor (pTyr) peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100416.webp&w=3840&q=75)
