Prodotto aggiunto correttamente al carrello.

Nessuna immagine
Nessuna immagine

Peptidi

I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.

Leggi di più

Sottocategorie di "Peptidi"

Prodotti di "Peptidi"

Ordinare per


Vedere altre categorie

Questa ricerca non contiene alcuna categoria.

prodotti per pagina. 31278 prodotti in questa categoria.

MarchioDati del prodottoPurezzaFascia di prezzoConsegna prevista
Biosynth logo
Dendroaspis Natriuretic Peptide
REF: 3D-VAC-00380
- - -467,00 €~2.092,00 €Gio 23 Gen 25
Biosynth logo
PKA Inhibitor Substrate
REF: 3D-VAC-00448
- - -166,00 €~626,00 €Gio 23 Gen 25
Biosynth logo
VIP (1-12), human, porcine, rat
REF: 3D-VAC-00485
- - -337,00 €~895,00 €Gio 23 Gen 25
Biosynth logo
[Arg91, Ala96]-MBP (87-99), human
REF: 3D-VAC-00795
- - -346,00 €~976,00 €Gio 23 Gen 25
Biosynth logo
Exendin 4 (3-39)
REF: 3D-VAC-00762
- - -341,00 €~1.276,00 €Gio 23 Gen 25
Biosynth logo
Biotin-Insulin Receptor (1142-1153)
REF: 3D-VAC-00124
- - -346,00 €~976,00 €Gio 23 Gen 25
Biosynth logo
HPV-E7-N
REF: 3D-VAC-00899
- - -252,00 €~1.003,00 €Gio 23 Gen 25
Biosynth logo
PDGFRtide
REF: 3D-VAC-00639
- - -256,00 €~711,00 €Gio 23 Gen 25
Biosynth logo
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
REF: 3D-PP47266
- - -887,00 €~2.324,00 €Gio 23 Gen 25
Biosynth logo
MMP Substrate I, fluorogenic
REF: 3D-VAC-00144
- - -170,00 €~640,00 €Gio 23 Gen 25
Biosynth logo
Adrenomedullin (1-52), human
REF: 3D-VAC-00919
- - -600,00 €~2.691,00 €Gio 23 Gen 25
Biosynth logo
Calpain Inhibitor Peptide
REF: 3D-VAC-00337
- - -256,00 €~1.017,00 €Gio 23 Gen 25
Biosynth logo
PKCe pseudosubstrate derived peptide
REF: 3D-VAC-00376
- - -166,00 €~626,00 €Gio 23 Gen 25
Biosynth logo
2A/2B Dengue Protease Substrate
REF: 3D-VAC-00048
- - -189,00 €~711,00 €Gio 23 Gen 25
Biosynth logo
α-CGRP (19-37), human
REF: 3D-VAC-00719
- - -188,00 €~746,00 €Gio 23 Gen 25
Biosynth logo
[D-Ala2] Met-Enkephalin, amide
REF: 3D-VAC-00838
- - -215,00 €~598,00 €Gio 23 Gen 25
Biosynth logo
PAR-1-selective peptide
REF: 3D-VAC-00761
- - -193,00 €~484,00 €Gio 23 Gen 25
Biosynth logo
beta-Bag Cell Peptide
REF: 3D-VAC-00671
- - -193,00 €~484,00 €Gio 23 Gen 25
Biosynth logo
Kinase Domain of Insulin Receptor (2)
REF: 3D-VAC-00771
- - -374,00 €~1.057,00 €Gio 23 Gen 25
Biosynth logo
GLP-2 (1-33) (human)
REF: 3D-VAC-00464
- - -390,00 €~1.556,00 €Gio 23 Gen 25
discount label

Dendroaspis Natriuretic Peptide


Ref: 3D-VAC-00380

1mg467,00 €
5mg1.255,00 €
10mg2.092,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

PKA Inhibitor Substrate


Ref: 3D-VAC-00448

1mg166,00 €
5mg422,00 €
10mg626,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

VIP (1-12), human, porcine, rat


Ref: 3D-VAC-00485

5mg337,00 €
10mg470,00 €
25mg895,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

[Arg91, Ala96]-MBP (87-99), human


Ref: 3D-VAC-00795

5mg346,00 €
10mg512,00 €
25mg976,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

Exendin 4 (3-39)


Ref: 3D-VAC-00762

1mg341,00 €
5mg813,00 €
10mg1.276,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

Biotin-Insulin Receptor (1142-1153)


Ref: 3D-VAC-00124

5mg346,00 €
10mg512,00 €
25mg976,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

HPV-E7-N


Ref: 3D-VAC-00899

1mg252,00 €
5mg632,00 €
10mg1.003,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

PDGFRtide


Ref: 3D-VAC-00639

5mg256,00 €
10mg400,00 €
25mg711,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH


Ref: 3D-PP47266

1mg887,00 €
10mg1.037,00 €
100mg2.324,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

MMP Substrate I, fluorogenic


Ref: 3D-VAC-00144

1mg170,00 €
5mg432,00 €
10mg640,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

Adrenomedullin (1-52), human


Ref: 3D-VAC-00919

1mg600,00 €
5mg1.615,00 €
10mg2.691,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

Calpain Inhibitor Peptide


Ref: 3D-VAC-00337

1mg256,00 €
5mg640,00 €
10mg1.017,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

PKCe pseudosubstrate derived peptide


Ref: 3D-VAC-00376

1mg166,00 €
5mg422,00 €
10mg626,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

2A/2B Dengue Protease Substrate


Ref: 3D-VAC-00048

1mg189,00 €
5mg480,00 €
10mg711,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

α-CGRP (19-37), human


Ref: 3D-VAC-00719

1mg188,00 €
5mg470,00 €
10mg746,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

[D-Ala2] Met-Enkephalin, amide


Ref: 3D-VAC-00838

5mg215,00 €
10mg336,00 €
25mg598,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

PAR-1-selective peptide


Ref: 3D-VAC-00761

5mg193,00 €
10mg290,00 €
25mg484,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

beta-Bag Cell Peptide


Ref: 3D-VAC-00671

5mg193,00 €
10mg290,00 €
25mg484,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

Kinase Domain of Insulin Receptor (2)


Ref: 3D-VAC-00771

5mg374,00 €
10mg555,00 €
25mg1.057,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
discount label

GLP-2 (1-33) (human)


Ref: 3D-VAC-00464

1mg390,00 €
5mg992,00 €
10mg1.556,00 €
Consegna stimata in Stati Uniti, il Giovedì 23 Gennaio 2025
Benvenuto su CymitQuimica!Utilizziamo i cookie per migliorare la tua visita. Non includiamo pubblicità.

Consulta la nostra Politica sui Cookie per maggiori dettagli o regola le tue preferenze in "Configura".