RSPRY1 antibody
Rif. 3D-70R-2813
100µl | 762,00 € |
Informazioni sul prodotto
RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY
Proprietà chimiche
Richiesta tecnica su: 3D-70R-2813 RSPRY1 antibody
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.