MGC50273 antibody
Rif. 3D-70R-4290
100µl | 762,00 € |
Informazioni sul prodotto
MGC50273 antibody was raised using the N terminal of MGC50273 corresponding to a region with amino acids MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE
Proprietà chimiche
Richiesta tecnica su: 3D-70R-4290 MGC50273 antibody
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.