CymitQuimica logo

β-Amyloid (1-40) Human

Rif. 3D-CRB1000087

1mg
651,00€
5mg
2.013,00€
100µg
386,00€
500µg
470,00€
β-Amyloid (1-40) Human
Biosynth

Informazioni sul prodotto

Nome:β-Amyloid (1-40) Human
Sinonimi:
  • H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHAbeta 1-40
Marchio:Biosynth
Descrizione:Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS.Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.

Proprietà chimiche

Peso molecolare:4,329.8 g/mol

Richiesta tecnica su: β-Amyloid (1-40) Human

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
◻️
CYMIT QUÍMICA, S.L., in qualità di responsabile del trattamento, tratterà i suoi dati per rispondere alle sue domande o richieste. Potete accedere, rettificare e cancellare i vostri dati, così come esercitare altri diritti consultando le informazioni supplementari e dettagliate sulla protezione dei dati nella nostra Informativa sulla privacy.
* Campi obbligatori.